(data stored in ACNUC7421 zone)

EMBL: CP000667.PE99

CP000667.PE99        Location/Qualifiers
FT   CDS_pept        105082..105849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0099"
FT                   /product="LamB/YcsF family protein"
FT                   /note="PFAM: LamB/YcsF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52584"
FT                   /db_xref="GOA:A4X134"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A4X134"
FT                   /protein_id="ABP52584.1"
FT                   /translation="MDLNADLGEGLGVWRLGDDAALLDLVTSANVACGFHAGDAVTMRR
FT                   VCAGAAERGVMVGAQVSYRDLVGFGRRHIAYEFAELRDEVIYQLGALDGFCRVAGTRVR
FT                   YLKPHGALYHAVTYDESQAAAVVAAVAEYDDQLALLCPSGSVLSQLANGAGLRAVSEGF
FT                   ADRGYQPNGRLVPRGAPNALVADPEQMAQQALRMATEQAVVAVDGTVIPCPVQSICLHG
FT                   DTPGAVRCAELIRAVLVDAGIPLAPFTGRGGRA"
     atggatctca acgctgatct cggtgagggc ctcggcgtct ggcggctcgg cgacgatgcg        60
     gcgctgctgg acctggtgac ctccgccaac gtcgcctgtg gcttccatgc gggcgacgcc       120
     gtcaccatgc gtcgggtctg cgccggggcc gccgagcgcg gagtcatggt gggcgcgcag       180
     gtcagctacc gggacctggt cggcttcggc cgccggcaca tcgcgtatga gttcgccgag       240
     ctgcgcgacg aggtcatcta ccagctcggg gccctcgacg ggttctgccg ggtggccggg       300
     acccgagtcc ggtacctcaa gccgcacggg gcgctctacc acgccgtcac ctacgacgaa       360
     tcccaggcgg cggcggtggt cgccgcagtc gccgagtacg acgaccagct cgccctgctc       420
     tgcccgtccg gctcggtgct ctcccagctc gcgaacggtg ccgggcttcg ggccgtcagc       480
     gagggcttcg ccgaccgggg ctaccagccc aacggcaggc tggtgccccg gggcgccccg       540
     aacgcgctgg tcgccgaccc ggagcagatg gcccagcagg ccctgcggat ggccaccgag       600
     caggcggtgg tggcggtcga cggcaccgtg attccctgcc cggtccagtc gatctgcctg       660
     cacggcgaca cccccggtgc ggtgcgctgc gccgagctga ttcgtgccgt gttggtggac       720
     gcgggaattc cgctcgcccc gttcacggga cgtggagggc gggcgtaa                    768
//

If you have problems or comments...

PBIL Back to PBIL home page