(data stored in ACNUC7421 zone)

EMBL: CP000675.ABCT3

CP000675.ABCT3       Location/Qualifiers
FT   CDS_pept        148542..149840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="abcT3"
FT                   /locus_tag="LPC_0142"
FT                   /product="ABC transporter, ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54141"
FT                   /protein_id="ABQ54141.1"
FT                   /translation="MPETIINIENLSKSFKKAPSQHLLVLEDVNFKLQEGEIVALLGKS
FT                   GSGKSTLLRIIAGLIAPSSGTVTYRGKPVTRPVEGIAMVFQSFALMPWLTVLENVELGL
FT                   EAQGISREERRHRAIEAIDIIGLDGFESAFPKELSGGMRQRVGFARALVINPDVLLMDE
FT                   PFSALDVLTAENLKSDLLELWKEKKTNTNGILLVTHNIEEAATLADRIVIFGNDPGYIR
FT                   AELPVTLPQPRDPESPEYLALVDKIYTLMTTGPKEKAKRAQRERQIGLGYRLPDVEPSE
FT                   LSGLIETMKSFEERIDLPELADELMMNIDDLFPILETLEILGFAKVSAGDIQLSELGKQ
FT                   FSEADLQERKQLFAQRLLEKVPLARYIRRVLDEKAGHRVSEERFLSKLEDYLSEKEADR
FT                   VLKTMIDWGRYAEIFAYDFNTGILSLENPGKGA"
     atgccggaaa caattattaa catagaaaat ttaagcaaat cttttaaaaa agcaccttct        60
     cagcaccttc ttgtacttga agatgttaat ttcaaattac aggaaggcga aatagttgct       120
     ttgttaggta aatctggttc agggaaatcc actttactca ggattattgc tggtcttatc       180
     gctccttcca gtggaacagt gacttaccgc ggtaaacctg taaccaggcc ggtagaaggc       240
     attgctatgg tatttcagtc gtttgcttta atgccttggc ttacagtcct ggaaaatgtg       300
     gagcttggtt tggaagcaca aggaatcagc cgcgaggaaa gaaggcatag ggctattgaa       360
     gcgatagata ttataggttt ggatggtttc gaatcggctt ttcccaagga gttatctggt       420
     gggatgcgac aacgggttgg ttttgctcgc gctttggtta ttaatccgga tgtgttgtta       480
     atggatgaac ccttttccgc gcttgatgta cttactgcag aaaacctcaa atcagattta       540
     ttggagttat ggaaagaaaa gaaaacgaat accaatggta ttttattagt aacacacaat       600
     atagaagaag ctgcgacttt ggctgacagg atagtgattt ttggtaatga tcccggctat       660
     attcgtgctg aattgccagt gactcttccc caaccccgtg acccggaaag cccggaatac       720
     cttgccttgg ttgacaagat ttatacttta atgactactg gacccaaaga aaaagccaag       780
     cgagcgcaaa gggagcgtca aataggttta ggctatcgct tacccgatgt cgagccctct       840
     gaattatccg gtctgataga aactatgaag tcctttgaag aacgtattga tttacctgag       900
     ctggcagacg agctcatgat gaatattgat gatctgttcc caattcttga aactctggag       960
     atacttggtt ttgccaaggt gtctgcggga gatattcagt taagtgaatt aggaaaacaa      1020
     ttttcagaag ctgatttgca agagcgtaag caattgttcg cgcaaagatt attggaaaaa      1080
     gtccctctgg ctcgttatat aagacgcgta ctggatgaga aagcggggca tcgcgtctcg      1140
     gaagagcgct ttttgagtaa gctggaggat tatttaagcg agaaagaagc agatcgtgtt      1200
     ttgaaaacaa tgattgactg gggacgatat gccgagattt ttgcttatga tttcaatacc      1260
     ggtattttga gtctggaaaa cccgggcaag ggggcttag                             1299
//

If you have problems or comments...

PBIL Back to PBIL home page