(data stored in ACNUC7421 zone)

EMBL: CP000675.ACCC

CP000675.ACCC        Location/Qualifiers
FT   CDS_pept        complement(556206..557549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /locus_tag="LPC_2881"
FT                   /product="acetyl CoA carboxylase, biotin carboxylase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2881"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56782"
FT                   /protein_id="ABQ56782.1"
FT                   /translation="MLSKIVIANRGEIALRILRACKELGIQTVAVHSDVDKDLLHVRLA
FT                   DETVCIGPAPAQKSYLNIPAIISAAEITDAVAIHPGYGFLSENADFADIVEQSGFRFIG
FT                   PRGDSIRLMGDKVSAIAAMKAAGVPCVPGSDGPLGDDDNKNLELARKIGYPIIIKAAGG
FT                   GGGRGMRVVHSESNLLSAIALTRSEAKAAFNNPIVYMEKFLENPRHVEFQVLGDGKGHA
FT                   IHLGERDCSMQRRHQKVVEEAPAPGITPELREEIGASVIKACKELQYRGAGTFEFLFQD
FT                   GCFYFIEMNTRIQVEHPVTEMITGIDLIKEQIKIASDIPLTLTQKDIKLRGHAIECRIN
FT                   AEDPRNFMPSPGTIKLLHQPGGPGVRFDSHIYSSYVVPPNYDSMIGKLISYGATRAEAI
FT                   ARMRNALDEIIIDGIKTNIELHQRILHDKSFMEGGTNIHYLEKMLKDS"
     atgctcagta aaatagttat tgctaaccga ggcgaaattg cgcttcgtat attacgtgct        60
     tgtaaagaac tcggcattca gactgttgct gttcattctg atgtagacaa agatttattg       120
     cacgttcgcc tggctgatga aaccgtatgc ataggccctg cgcctgccca aaaaagctat       180
     ctcaatattc ctgcaattat atctgcggca gaaattactg atgcagtggc gatacatcca       240
     ggttatggat ttttatcaga aaatgctgat tttgcagata ttgttgagca aagcggtttc       300
     cgttttattg gcccacgcgg cgactccatt cgtcttatgg gggataaagt ttccgcgatt       360
     gctgccatga aagcggcagg agtaccctgt gttcccggtt cagacggtcc tttaggagat       420
     gacgacaaca aaaatctgga gttggcgcga aaaattggtt atccaatcat tatcaaagca       480
     gccggcggcg gtggtggacg tggcatgaga gtcgtacaca gcgaatccaa tttacttagt       540
     gctattgcgt taacccgaag cgaagcaaaa gccgctttca ataatccgat agtttacatg       600
     gaaaaatttc tggaaaatcc tcgccatgtt gaattccaag tacttggtga tgggaaaggg       660
     cacgctatac atttgggtga acgtgattgc tcgatgcaaa gacgacatca aaaagtcgta       720
     gaagaagccc cggctccagg aatcactcct gaattaaggg aagaaattgg cgcgtcagtg       780
     attaaagctt gcaaagagtt acaataccga ggtgctggaa cctttgaatt tttatttcaa       840
     gatggttgtt tttatttcat cgaaatgaat acgcggattc aggttgagca tccagtaact       900
     gaaatgatca ctggtattga tttaattaaa gaacaaatca aaattgccag cgatatacct       960
     ctaacattaa cccaaaaaga tattaaatta cgcggccatg ctattgaatg ccgaatcaat      1020
     gcggaagatc ccaggaattt tatgccctct cctggaacca taaaattact tcatcaacca      1080
     ggaggtccag gcgttcgttt tgattctcac atctacagca gctatgttgt tccacctaat      1140
     tacgattcca tgataggaaa attaataagt tatggggcga caagagcaga agcgattgcc      1200
     aggatgcgta atgctcttga tgaaattatc attgatggca taaagacaaa tattgaatta      1260
     caccaacgta ttcttcatga caaatctttt atggaaggtg gcacaaacat tcactatcta      1320
     gaaaaaatgc tcaaggattc atag                                             1344
//

If you have problems or comments...

PBIL Back to PBIL home page