(data stored in ACNUC7421 zone)

EMBL: CP000675.ACPP

CP000675.ACPP        Location/Qualifiers
FT   CDS_pept        453258..453671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpP"
FT                   /locus_tag="LPC_2985"
FT                   /product="acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2985"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56886"
FT                   /protein_id="ABQ56886.1"
FT                   /translation="MNVAEVYPKVREIIADVLVIDEEEISLNSSLIEDLGAESIDFLDL
FT                   VFQLEKEFKIKIPRGQLEKNARGDLAEDEFEKGGILTTSGLQALKNYLSEVPADRFKEN
FT                   MKVNEIPVLFTVETFCKLVISAIAQQQATETVA"
     atgaatgtag ctgaagttta ccctaaggtt agggaaatta ttgctgatgt attagtaatt        60
     gatgaagaag aaatttcttt aaacagtagt ttaattgaag atttgggtgc tgagtccatc       120
     gattttcttg atttggtttt tcaattggaa aaagaattca agattaaaat cccgagaggc       180
     cagttggaaa agaatgctcg tggtgatctg gctgaggatg aatttgagaa aggtggtatt       240
     ttaacaacct caggattaca ggctttaaag aattatttga gcgaagttcc tgctgatcga       300
     tttaaagaga atatgaaagt taacgaaatt cctgtgttgt ttaccgtaga aactttttgc       360
     aagctggtta tttcagctat agcccagcag caagcaacgg aaactgtagc ctga             414
//

If you have problems or comments...

PBIL Back to PBIL home page