(data stored in ACNUC7421 zone)

EMBL: CP000675.ARTJ

CP000675.ARTJ        Location/Qualifiers
FT   CDS_pept        complement(43941..44684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="artJ"
FT                   /locus_tag="LPC_0038"
FT                   /product="arginine 3rd transport system periplasmic binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54038"
FT                   /protein_id="ABQ54038.1"
FT                   /translation="MVRLRIYLCSLLLVIPFYSGYALNLVIGTLSYNPPFEIQVNNPSK
FT                   ENEFYGFEIELMNEICKRINAKCQYKPLLFEQILAEINSGAINLGIGSINITPERSERF
FT                   LFSLPYKSSYHQFLIPSNSNIKKIDDLKGKTIGIHLGSPTIDYLKVYFNNNIQFKYYET
FT                   FMDLLNGLTDPQVSAIVTNSDQAQYWASSTPDCKLLGDGFPFGIGFGVVARLDQAELIE
FT                   KINQALIEIENDGTYLKIYNLFFQP"
     atggttcgtc tcagaattta tttatgttct ttgctactgg ttattccctt ttatagtggg        60
     tatgctctta atttggtcat agggaccttg tcttataatc ctccttttga aattcaggtc       120
     aacaaccctt ccaaggaaaa tgagttttat ggttttgaaa ttgaactaat gaatgagatt       180
     tgcaaacgca tcaatgcaaa atgccaatac aagccattgt tatttgaaca aattttagct       240
     gaaattaatt ctggtgcaat caatttaggc attggcagca ttaatattac gcctgaaaga       300
     agcgaacgat ttttattcag ccttccctac aaatccagct atcatcagtt tcttatacca       360
     tctaactcga atataaaaaa aattgacgat ctcaaaggaa aaactatagg aattcattta       420
     ggttcaccta ctatcgatta tttaaaggtc tactttaaca ataatattca atttaaatat       480
     tacgaaacat ttatggattt acttaatggg ctgactgatc cgcaagttag cgcaatagtg       540
     actaatagcg atcaagcgca atactgggca tcaagtacac cggactgtaa gttattgggc       600
     gacggttttc cttttggaat aggatttgga gttgtcgcga gattagatca agcggaactg       660
     attgaaaaaa ttaatcaggc attaattgag attgaaaatg atgggactta ccttaaaata       720
     tataacctct tctttcaacc ttaa                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page