(data stored in ACNUC7421 zone)

EMBL: CP000675.COMM

CP000675.COMM        Location/Qualifiers
FT   CDS_pept        complement(716709..718220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comM"
FT                   /locus_tag="LPC_2712"
FT                   /product="competence related protein ComM"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2712"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56623"
FT                   /protein_id="ABQ56623.1"
FT                   /translation="MNLAFTKTRSTIGIVAQPVSVEVHLSNGLPSFTMVGLAETAVKES
FT                   KDRVRSAIINSQFEFPCRKITVNLGPANLPKTGSGFDLPIALGILAASEQIPLTNLANH
FT                   EFIGELALSGELRGVSAIIPAVLAAHKDNQYLIIANANAAEASLTGHPKVFTANNLREV
FT                   CDYLCQGTSLQNLPPKPDLLLNNHELDWSDIKGQHHAKNAMVIAACGGHSILLSGAPGS
FT                   GKTMMAKRFSTLLPELSETQALECAAINSIRGKLPDFREWRLPPFRAPHHTASPVALVG
FT                   GGNPPKPGEISLAHHGVLFLDELPEFNRQVLETLREPLESGHICISRAAAQIEFPAKFQ
FT                   LIAAMNPCPCGQWGNSQANCLCTPDRISRYLAKLSAPLLDRIDMQVTIHALSQEELIKP
FT                   NTHLEKQSPAIREKVTKMHEIQMARQDSLNANLNSKTCEMVCELGSEEQLFLREVMSKL
FT                   KLSARGYHRLLKVSRTIADMSECNKVMLNHLQQALSYKQILHLPK"
     atgaatctcg catttaccaa aacgcgaagt actattggta ttgtcgcaca accagtatct        60
     gtggaagtcc atttatcaaa tggattgcca agttttacta tggtaggact tgctgaaaca       120
     gcagtgaaag aaagtaaaga ccgcgtgcgc agcgccatta taaatagcca attcgaattt       180
     ccatgccgta aaattaccgt taatcttggc cctgccaatt tacctaaaac gggaagtggc       240
     tttgacttgc ctattgcact agggatactc gcagcatcag aacaaattcc tctcaccaac       300
     cttgcaaatc acgaatttat tggagaattg gctttaagcg gcgagcttag aggggtttct       360
     gccattatac ctgctgttct tgccgctcat aaagacaatc aatatcttat tatagcgaat       420
     gccaatgctg ccgaagcttc tttaaccggc cacccaaaag tctttactgc caataactta       480
     cgcgaagttt gtgattatct atgccagggt acttctttac agaacttacc tcccaaacca       540
     gatcttttat taaataacca tgaattggat tggtctgata ttaaggggca acatcatgcc       600
     aaaaatgcta tggtcattgc tgcctgtggg ggacacagca ttctgctaag tggcgcgccg       660
     ggcagtggaa aaacgatgat ggcaaaaaga tttagtacct tgctacccga gctatccgaa       720
     acacaagctc tcgaatgcgc agccattaat tcaattcgag gcaaattacc tgatttcagg       780
     gaatggcgtt tgcctccttt tcgcgcacca catcatactg cttcacctgt cgcattagtc       840
     ggaggaggca acccgccgaa acccggtgaa atttcattag cccatcacgg cgtattattt       900
     ttagatgaat tacctgaatt taatcggcaa gtactggaga cacttagaga acctttggag       960
     tcagggcata tttgcatttc tagggcagct gcacaaatag agtttcctgc caaatttcaa      1020
     ttaattgcag caatgaatcc ttgcccttgt ggccaatggg gtaattcaca agctaattgc      1080
     ttatgtactc ctgatagaat cagccgctat ttggcaaaac tttctgctcc attattagat      1140
     agaatcgata tgcaggttac aattcacgca ttatctcaag aggagttaat taaacccaat      1200
     acccatttag aaaaacaaag tcctgctatt agagaaaagg taacaaagat gcatgaaata      1260
     caaatggcac gacaagatag tctcaatgcc aatttaaatt ccaaaacatg cgaaatggtt      1320
     tgcgaattgg gatcagaaga acaattgttt ctccgagaag tgatgagtaa actgaaactg      1380
     tctgctcgtg gttaccatcg cttactaaaa gtaagcagga caattgctga tatgagtgaa      1440
     tgtaataagg tcatgctaaa ccatctgcaa caggcgttat cctataaaca aatcttgcat      1500
     ttgcctaaat aa                                                          1512
//

If you have problems or comments...

PBIL Back to PBIL home page