(data stored in ACNUC7421 zone)

EMBL: CP000675.CRCB

CP000675.CRCB        Location/Qualifiers
FT   CDS_pept        603966..604370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crcB"
FT                   /locus_tag="LPC_2834"
FT                   /product="CrcB protein, camphor resistance"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2834"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56735"
FT                   /db_xref="GOA:A5IH85"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IH85"
FT                   /protein_id="ABQ56735.1"
FT                   /translation="MVVAPYLAVAIGGSLGAMSRYLVTIMAQNAWGIKFPYGTLLVNTL
FT                   GSFLAGFFLIVLVGRFSAEESFRLFLFTGFLGAFTTFSSFAAESLFMFEQGYWFKLITN
FT                   ILVNNVGSLSMVFIGTLVAKYVLLGHQGSN"
     atggttgttg caccttactt ggctgtagct atcggaggct ctttaggcgc aatgtctcgt        60
     tatttagtta caataatggc tcaaaatgcc tgggggatta aatttcctta tggtactctt       120
     ttagtgaaca cactaggttc ttttctagct ggtttttttc ttattgtatt agtaggtcgt       180
     tttagcgccg aggagtcgtt tcgtttattc ctttttacgg gatttttagg agcttttact       240
     accttttcga gtttcgctgc agaatcttta tttatgtttg agcaaggata ttggtttaaa       300
     ttaattacca atatactggt caataatgtt ggctcattgt ccatggtctt cattggaaca       360
     ttagttgcta aatatgtatt attaggacat cagggctcca attaa                       405
//

If you have problems or comments...

PBIL Back to PBIL home page