(data stored in ACNUC7421 zone)

EMBL: CP000675.DCOA

CP000675.DCOA        Location/Qualifiers
FT   CDS_pept        558696..560486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcoA"
FT                   /locus_tag="LPC_2878"
FT                   /product="oxaloacetate decarboxylase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2878"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56779"
FT                   /protein_id="ABQ56779.1"
FT                   /translation="MSKTFITDVTLRDAHQCLIATRMRTEDMLPICNKMDDVGFWAMEV
FT                   WGGATFDACLRFLKEDPWSRLRQLRQALPNTQLSMLLRGQNLLGYRNYADDVVRAFVKL
FT                   AVNNGVDVFRVFDALNDARNLKVAIDAIKSHKKHAQGAICYTTSPVHTLDNFLELGKKL
FT                   AEMGCDSIAIKDMAGLLTPTVTVELYAGLKQATGLPVHLHSHSTSGLASICHYEAVLAG
FT                   CNHIDTAISSFSGGASHPPTEALVAALTDTPYDTELDLNILLEIDDYFKAVRKKYSQFE
FT                   SEAQNIDPRVQLYQVPGGMISNLYNQLKEQNALDKMDAVHKEIPRVRKDLGYPPLVTPT
FT                   SQVVGTQAVINVLTGERYKTITNEVKLYCQGKYGTPPGKISSALRKKAIGRTEVIEVRP
FT                   GDLLPNELDQLQNEISDLALSDEDVLLYAMFPEIGRQFLEQRKNNQLIPEPLLTQSSAP
FT                   DNSVMSEFDIILHGENYHVKVAGYGMIEHGQQSCFLWVDGVPEEVVVQHSELHDKIERS
FT                   SVNNKIGPGDITVAIPGSIIAIHVSAGDEVKAGQAVLVIEAMKMETEIKAPANGVVAEI
FT                   LCQKGDKVTPGQVLIRVEVS"
     atgtctaaaa cgtttataac agatgtcacc ttgcgtgatg cccatcaatg cttaatcgct        60
     acaagaatgc gtactgaaga tatgttgcca atctgtaata aaatggatga tgtaggattt       120
     tgggctatgg aagtctgggg aggcgctact tttgatgcct gtttgcgatt tttaaaggaa       180
     gatccctggt caagattgcg tcaacttcgc caggcgttac cgaatactca actctccatg       240
     ctgttaagag gtcaaaactt gttaggctat aggaattatg cagatgatgt agtccgagcg       300
     tttgttaaat tggccgtaaa taatggagtg gatgtatttc gtgtgtttga tgctttaaat       360
     gacgcgcgaa accttaaagt agccatagac gcgattaaat cacataaaaa acatgcccag       420
     ggagcaattt gttacacaac cagcccggtt catactttgg acaatttttt ggagctaggg       480
     aaaaaattgg ctgaaatggg atgtgatagt atcgccataa aagatatggc aggtttgcta       540
     accccaacgg tgactgtcga attgtatgcc ggtttaaaac aagcgactgg cttacctgta       600
     catttgcata gtcattctac ttccggtttg gcaagtatat gccattatga ggccgtttta       660
     gcgggttgta atcacattga tacagcgatt tcatcttttt ctggcggtgc gtctcatcca       720
     cctacggaag cattggttgc cgcattgact gacactccgt atgacacgga attggattta       780
     aatattttat tggaaataga cgattatttt aaagctgtcc gcaagaagta ttctcaattt       840
     gaaagtgagg cacagaatat tgaccctcgt gttcaattgt atcaagtgcc aggtggcatg       900
     atctcaaacc tgtataatca gttaaaggag cagaatgcat tagacaagat ggatgctgtt       960
     cacaaggaaa tcccccgcgt tcgtaaggac ttgggttatc cgcctttggt tacgccaaca      1020
     tctcaagtcg ttggaactca ggcagttatt aatgttctaa cgggagaacg gtataaaaca      1080
     ataaccaatg aagtgaaact ctactgtcag ggaaaatatg gcactcctcc tggcaaaatt      1140
     agttctgctt tacggaaaaa agcgattgga cgaacggaag tgattgaagt caggcctggc      1200
     gatttgttac ctaatgaatt agatcaattg caaaatgaaa taagtgattt ggcactaagt      1260
     gatgaggatg ttcttcttta tgcaatgttt cccgaaattg ggcgccaatt cttagagcag      1320
     cgtaaaaata atcaattaat tcctgagcca ttattgactc aatcaagtgc accagataat      1380
     tccgtcatgt ctgagtttga tattattctt catggtgaga attatcatgt aaaagtagct      1440
     ggttatggaa tgattgagca tggtcaacaa tcctgttttt tgtgggttga tggtgttcct      1500
     gaagaagttg ttgtgcaaca ttctgaactt catgacaaaa tagagcgttc atctgttaat      1560
     aacaagatag gacctggaga tattactgta gctatccccg gttctattat tgcaattcat      1620
     gtttctgctg gtgatgaagt caaggccggg caggctgtat tggttattga agcaatgaaa      1680
     atggagacag aaataaaagc acctgcaaat ggggtggttg cagaaatatt atgtcaaaag      1740
     ggagacaaag tgactccagg gcaagtatta atcagagtgg aggtgagtta a               1791
//

If you have problems or comments...

PBIL Back to PBIL home page