(data stored in ACNUC7421 zone)

EMBL: CP000675.DNAA

CP000675.DNAA        Location/Qualifiers
FT   CDS_pept        655..2013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="LPC_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54001"
FT                   /db_xref="GOA:A5I9F1"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5I9F1"
FT                   /protein_id="ABQ54001.1"
FT                   /translation="MSTTAWQKCLGLLQDEFSAQQFNTWLRPLQAYMDEQRLILLAPNR
FT                   FVVDWVRKHFFSRIEELIKQFSGDDIKAISIEVGSKPVEAVDTPAETIVTSSSTAPLKS
FT                   APKKAVDYKSSHLNKKFVFDSFVEGNSNQLARAASMQVAERPGDAYNPLFIYGGVGLGK
FT                   THLMHAIGNSILKNNPEAKVLYLHSERFVADMVKALQTNSINEFKRFYRSLNALLIDDI
FT                   QFFAGKDRSQEEFFHTFNALLEGQQQIILTSDRYPKEIEGMEERLKSRFGWGLTVAVEP
FT                   PELETRVAILISKAEQSNIELPYEVAFFIAKRIRSNVRELEGALRRVIANAHFTGKPIT
FT                   IEFVHEALRDLLALQDKLVTIENIQKTVAEYYKVKVADLLSKRRSRSIARPRQMAMALS
FT                   KELTNHSLPEIGDHFGGKDHTTVIHACRKVKELIQDDSDFAEDYKNLMRILSS"
     gtgtcaacta ctgcttggca aaaatgttta ggtttgttgc aagatgaatt ttctgctcag        60
     caatttaata cttggttgcg ccctttacaa gcttacatgg acgagcagcg tttaatctta       120
     ttagcgccta atcgtttcgt tgttgattgg gttagaaaac attttttttc tcgtattgaa       180
     gagttgatta aacagttctc cggcgatgac atcaaagcta tttctattga agtaggtagt       240
     aagcctgtcg aagctgttga tacgcctgct gaaacaattg tcacttcatc tagtacagca       300
     cctctaaaat ccgctcctaa aaaagcagtt gactataaaa gcagtcactt aaataaaaaa       360
     tttgtttttg acagctttgt cgaaggaaat tcaaatcaac tggcgagagc tgcgtccatg       420
     caggtagccg agcgccctgg ggatgcttat aatcccttat ttatttatgg gggagtgggc       480
     ttaggtaaaa cacatctcat gcatgccatt ggtaatagta ttttaaagaa taatcctgag       540
     gctaaagtat tgtatttgca ttcagaacgt tttgttgcag atatggttaa agcattgcaa       600
     acaaattcta ttaatgaatt taaacgattt tatcgttctt taaatgcttt acttatagat       660
     gatattcagt tttttgcggg gaaggacagg tcacaagagg aattttttca tacttttaac       720
     gccttactgg aaggacaaca gcaaatcatt ttgaccagtg atcgatatcc taaggaaata       780
     gaagggatgg aagagcgttt aaaatctcga tttggttggg gattgactgt agcagtggag       840
     cctccagagt tagaaacgcg cgtcgcaatc ttaattagta aagctgagca atctaatatt       900
     gaattgcctt atgaagtagc cttttttata gccaaacgta tacgttcgaa tgtcagagaa       960
     cttgaaggtg ccttgcgtcg agttatagcc aatgctcact ttactggtaa gccgataact      1020
     attgaatttg tacatgaagc attacgtgat cttctagctt tacaagataa gttagttact      1080
     atagaaaata tccaaaaaac ggtagctgaa tattataaag taaaggtcgc tgatttactt      1140
     tcaaaacgca gaagccggtc tattgcaaga ccaaggcaaa tggcaatggc tttgagtaaa      1200
     gaattgacta atcatagttt acctgaaatc ggtgatcatt tcggtggtaa ggatcatacg      1260
     acagtcatac atgcctgtcg gaaggttaaa gaattaatcc aggatgatag cgattttgct      1320
     gaagattata aaaatttaat gcgaatatta tcttcttga                             1359
//

If you have problems or comments...

PBIL Back to PBIL home page