(data stored in ACNUC7421 zone)

EMBL: CP000675.DOTV

CP000675.DOTV        Location/Qualifiers
FT   CDS_pept        566914..567456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dotV"
FT                   /locus_tag="LPC_2872"
FT                   /product="IcmC (DotV)-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2872"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56773"
FT                   /protein_id="ABQ56773.1"
FT                   /translation="MNTIDLITILGNISQSLYPVQKLITGGAYILGVLFFLTAIGKLKK
FT                   IGDHRAQSSSQEKMFTPMMYLLVGALLIYLPSGMDLMANTAFGVGNVLTYSNYNPANIY
FT                   SSMGFLIRTAGVLWFIRGCVLVAHSSQPGTQQGLKGLVFLIAGVFAMNFDNTIAMINSA
FT                   LDYFVKATLSVKAAAGF"
     atgaacacga tagatttaat cactatatta ggtaatatta gccaatccct ttatcctgtg        60
     caaaaactta tcacaggagg agcttatata ttgggtgtct tatttttttt aacggcaatt       120
     ggcaagttaa aaaaaatcgg ggatcatcgg gctcaatcct cctcacagga aaaaatgttt       180
     actccaatga tgtatttatt agttggggca cttttaatct acttgccttc gggtatggat       240
     cttatggcaa ataccgcttt tggtgtcggt aatgtattaa cttattccaa ttataatcct       300
     gccaatatct acagttcaat ggggttttta attcgcacgg cgggtgttct gtggtttata       360
     cgtggatgtg tacttgtcgc tcattccagc cagccaggta ctcaacaagg attaaaagga       420
     ttggtatttc ttattgcagg cgtttttgca atgaattttg ataatacgat tgccatgatt       480
     aattctgctt tagattattt tgtcaaagca actttatcag taaaagccgc agcgggattc       540
     tag                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page