(data stored in ACNUC7421 zone)

EMBL: CP000675.FABA

CP000675.FABA        Location/Qualifiers
FT   CDS_pept        453671..454567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabA"
FT                   /locus_tag="LPC_2984"
FT                   /product="3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl
FT                   carrier protein) dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2984"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56885"
FT                   /protein_id="ABQ56885.1"
FT                   /translation="MRFLFVDRIVQLSPGEWIKGIKHVTRDDAYLTTDDQGRLCFMPSL
FT                   IGETLGQLAAWNVMQHNHFTSRPVAGVVSSARLYRPAYVGETILLESNIDSLDEKAVQY
FT                   HSIAKVGNDIIFTIDGALGPMLPMTEFISTEVIRQQFAEIYRPGEWSSVLALSSPVLIE
FT                   ENCSDCGMINSSMQFDRVLASEPGISLIAEKRITRSASYFPDHFPNRPVLPMTVLLECK
FT                   LNLAKEFIARAKYDRAYRISELRKIKMNEFVHPGDVVVCQVKVKQQMDDELILSYRCEV
FT                   DGKRVCVVDIVLIPKGK"
     atgaggttct tatttgttga tcgcattgta caattatccc caggagaatg gattaaaggg        60
     ataaagcatg tcacaagaga tgatgcttat ttaaccactg atgatcaagg aaggctttgc       120
     tttatgcctt ctttgattgg tgaaacattg gggcaattgg cagcgtggaa tgtgatgcaa       180
     cataatcatt ttacttcaag gccagtcgct ggcgtagtat caagtgcccg attgtatcga       240
     cctgcttacg tcggtgaaac gatattgctt gaatcaaata ttgattcact ggatgaaaaa       300
     gcagttcaat accatagcat tgccaaagta ggtaatgata ttatttttac tatagatgga       360
     gcattaggcc ccatgctgcc tatgactgaa tttattagta cagaggtcat tagacagcag       420
     tttgcagaga tatacaggcc aggtgagtgg tcttctgtgt tagctttgag ttcgcctgtt       480
     ttaatagagg aaaactgctc tgattgtgga atgattaatt cttccatgca atttgacaga       540
     gttctcgcca gtgaaccagg tataagcttg attgctgaaa aaaggataac tcgttcagca       600
     tcttatttcc cagatcattt tcctaacaga cctgtactac cgatgacggt acttcttgaa       660
     tgtaaattga atttggcgaa agaatttata gctagagcaa aatatgatag agcttatcga       720
     atcagcgaat tacgtaaaat taaaatgaat gaatttgttc atcccggaga tgtcgtagtt       780
     tgccaggtca aagtgaaaca gcaaatggat gatgaattaa tactgtctta taggtgtgag       840
     gttgatggca agcgggtatg tgttgtcgac atagtgctta tcccaaaagg taaatga          897
//

If you have problems or comments...

PBIL Back to PBIL home page