(data stored in ACNUC7421 zone)

EMBL: CP000675.FABF

CP000675.FABF        Location/Qualifiers
FT   CDS_pept        complement(125504..126733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabF"
FT                   /locus_tag="LPC_0121"
FT                   /product="3-oxoacyl-(acyl carrier protein) synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54120"
FT                   /protein_id="ABQ54120.1"
FT                   /translation="MKKRVVITGMEITSSIGSGIDKFWLAASQGQCGIKRIQSYDPSPY
FT                   STQIAGEITDLSLDHLPEFNKSKRYPRAAQYALFCAHHAIEKAGLEQAELNAAGTFIGT
FT                   SIGGQPELEAGYRLFFTDSWKKIPPLSVIRGMPNSIANHIAIAFGIGGPNSTISNACVS
FT                   SGEAIGMAYQQIAHGNLTTALCGGTESLVWESVMAAWCKLRVMSTNNENPSQASRPFDL
FT                   NRDGMVMADGAGILILEELQQAKARGAQILGEIIGYGASCDAFHVTAPNSQGQARAIVA
FT                   ALNDAKLSINDVHYINAHGTGTQLNDSTETETIKMVFGKRAYDIPITAQKAMTGHAIGA
FT                   AGAMEIIATTLSLQKNTLLPTINLHTPDPACDLDYVPNAAREKTIDIALSNHFAFGGAN
FT                   AALVLRKYIS"
     atgaaaaaaa gggttgttat tactggcatg gaaataacgt catccatagg atcgggaatt        60
     gataaatttt ggcttgctgc atctcaaggt caatgcggaa ttaaacgcat ccaatcttat       120
     gatccatccc cctattcgac ccaaatagca ggtgagatta cagacttatc tcttgaccat       180
     ctccccgaat tcaacaaaag caaacgttat cctcgcgctg ctcagtacgc attattttgc       240
     gcacatcatg ccattgagaa agcagggctt gagcaagctg agctcaatgc agcaggcacc       300
     tttataggca caagcattgg cggccaacct gaactggaag caggttacag gttattcttt       360
     acagacagct ggaagaaaat cccccctctt agcgtgatta gggggatgcc taattcaatc       420
     gccaatcata tcgcaattgc ttttggcata ggtggaccaa actcaaccat ttccaatgcc       480
     tgtgtttcat ccggggaagc gataggtatg gcttaccaac aaattgccca tggcaatttg       540
     accacagctc tttgcggagg aacagaatct ttagtctggg aatcggttat ggctgcctgg       600
     tgtaagctta gagtaatgtc aactaacaat gaaaatccct cacaagccag cagaccgttt       660
     gatctcaatc gggatggaat ggttatggcg gatggggctg ggatattaat tcttgaagag       720
     ctacaacaag caaaagcaag gggagcacaa attctcggag agatcattgg ctatggcgca       780
     agttgtgatg cattccatgt cacagcacca aactcacaag gacaagcaag agctattgtt       840
     gctgctttaa atgatgccaa gttatcaatt aacgatgtcc attacatcaa cgcacatggg       900
     acaggaaccc agctcaatga cagcacagaa acagaaacga ttaaaatggt tttcggtaaa       960
     agagcctatg acatcccgat tactgctcaa aaagccatga caggacatgc gattggggca      1020
     gcaggggcaa tggaaatcat tgcaacaaca ctaagcttgc aaaaaaatac gctgttaccg      1080
     actattaacc tgcatactcc agacccagcc tgtgatctgg attatgtgcc taatgctgcg      1140
     cgagaaaaaa ccattgatat tgctttatcc aaccatttcg ctttcggtgg agcaaatgcc      1200
     gctttagttc tgcgcaaata cattagttaa                                       1230
//

If you have problems or comments...

PBIL Back to PBIL home page