(data stored in ACNUC7421 zone)

EMBL: CP000675.FABFC

CP000675.FABFC       Location/Qualifiers
FT   CDS_pept        454572..455864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabFc"
FT                   /locus_tag="LPC_2983"
FT                   /product="3-oxoacyl-(acyl carrier protein) synthase II,
FT                   C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2983"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56884"
FT                   /protein_id="ABQ56884.1"
FT                   /translation="MKRRVAITGLGVVSPLGNDVSTTWNNLIAGYSGIDSIKQFDASAF
FT                   PTTIAAEVKNFSPDTSISGKHTRFIMSFTHFALEAARQAFEDASIFPTKQTSDRWGIVT
FT                   GSGMMTAEFEYLTRFQQTCAADGEIDWGKLQSNSRDFYNLVDFGKTTSNSGLSLLIQQY
FT                   GITGYASSVHTACASGGQALGLAMQVIRRGEADFMLAGGFDSMINPLGLSSFCLLGALS
FT                   TYNETPQTASRPFDATRNGFVLGEGAAFLILEEWSKAKARGAKIYAELAGEGNSLSSYR
FT                   ITDSHPNGDGAIQAIKRALEDAGVQPRDVDYINAHGTSTKMNDLSETNAIKVVFGDRIA
FT                   NLPVSSTKSQTGHLIAAAGALEAVLSVKSIEQAQVPKTANLKTPDPECDLDYVVDGPRE
FT                   KSLGVVLSNSFGFGGSNSCLLFKHPEFEEAK"
     atgaaacgac gagttgctat tacaggtcta ggggttgttt cgcctctagg aaatgatgta        60
     tccaccactt ggaacaattt gatcgccggc tattctggca tagatagtat caagcagttt       120
     gatgccagtg cttttcctac cactattgct gctgaagtaa agaacttttc acctgatacg       180
     tctatttcgg gaaagcatac acgatttatc atgtctttta ctcattttgc attggaagct       240
     gcacgccagg cttttgagga tgcttctatc ttccctacca agcaaacatc cgatcggtgg       300
     ggaattgtaa caggcagtgg gatgatgacg gccgagtttg agtatttaac gcggtttcaa       360
     caaacttgtg ctgcagacgg tgaaattgat tggggaaagc tgcaatctaa tagcagggat       420
     ttctataatt tggttgattt tggtaaaacc acttcaaact ctggtctttc cttattaata       480
     caacaatatg ggattactgg ttatgcctct tctgtccata cggcctgcgc ttcaggaggc       540
     caagccttgg gattggcaat gcaggtgatt cgtcgtggcg aggcagattt tatgttggca       600
     ggtggatttg attccatgat taatcctttg ggtttgtcga gtttttgtct tttgggtgcc       660
     ttatcaactt ataatgagac tccgcaaacg gcaagtcgcc cctttgatgc gacacgcaat       720
     ggttttgtcc tgggtgaagg agctgccttt ttgatccttg aagaatggag taaagcaaaa       780
     gctcgtgggg caaaaatcta tgctgaactg gctggagagg ggaattcttt gagctcctac       840
     cgaataactg attcacatcc caacggcgat ggtgctattc aagcgattaa acgtgcgttg       900
     gaagatgccg gggttcaacc acgggatgtc gattatatta acgcgcatgg tacatccact       960
     aaaatgaatg atttaagtga aaccaatgca atcaaagttg tcttcgggga taggatcgcc      1020
     aatttacctg ttagctctac caaaagccaa acggggcatt taatcgcagc ggcgggagca      1080
     cttgaagcgg tattgtcagt taaatccata gaacaggcgc aagtccccaa aacagcgaat      1140
     ttaaaaacac ctgatccgga gtgtgatttg gattatgttg ttgatggccc acgtgaaaaa      1200
     tctttagggg tagtattatc taattcgttt ggttttggag gttctaatag ctgcttgtta      1260
     tttaaacatc cagaattcga ggaggcaaaa taa                                   1293
//

If you have problems or comments...

PBIL Back to PBIL home page