(data stored in ACNUC7421 zone)

EMBL: CP000675.FIXL

CP000675.FIXL        Location/Qualifiers
FT   CDS_pept        complement(384739..386154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixL"
FT                   /locus_tag="LPC_0355"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54350"
FT                   /protein_id="ABQ54350.1"
FT                   /translation="MTEMHRLLQRQLKKFGFTADGLPQNLESWTQFIAHINKTYYENDQ
FT                   DRYLLERSIDISSKEMRDINSKLEYAQDIAQMGYWHYDADTDTATWSKGLFKILGLPPS
FT                   NVVLNLSSFLELVHPNDIAGLKKVVEKALKEKEDYDYELRVRNQDNDYKWFRTIARANP
FT                   HKNEISGVLMDISKRKIIEEQVLELNNKLVSTARLAGMSEVATSILHNVGNILNSVNVS
FT                   AIILKKNISKIHYKKLSAIKTMLDENINQLSEYLLNNPKGKLVLPYLDALSKTLHEEYE
FT                   ENMKEANSLETNINHIKEIIAMQQSLSGLSNLTEKISIHDVILNAVKSVILDKHQIDVR
FT                   IEIEPDINEFITDKSKLFQILTNLLANAKDSVLLHEANASRTIVISIGRTEKNHIMIKI
FT                   NDNGIGIQKDNLDRIFSFGFTTKKNGHGFGLHCSAIYARDLGGTLYAESNGNGEGAQFV
FT                   LDLPINPKTLSPR"
     atgacagaaa tgcatcggtt gttgcagcga cagttaaaaa aatttggttt tactgctgat        60
     ggattaccac aaaatctgga gagttggact caatttattg cacatatcaa taaaacatac       120
     tacgaaaatg atcaagaccg atatttatta gagcgctcta ttgatatttc ttctaaagaa       180
     atgagggata tcaattcgaa actcgaatac gcccaggata tagctcaaat ggggtattgg       240
     cattatgacg cggacacaga taccgcaaca tggtccaaag ggctatttaa aattctgggt       300
     ttgccgccta gtaatgtagt gctgaacttg tcttcatttt tagagcttgt gcatcctaat       360
     gatatagcgg gattaaaaaa agtggtcgaa aaggctctca aagaaaaaga agattatgat       420
     tatgaactca gagtaagaaa ccaagacaat gattataagt ggttccgaac gatagcaaga       480
     gccaatcctc ataaaaatga aatttccggg gttttgatgg atatctccaa aaggaaaatt       540
     attgaagagc aagttcttga actaaataat aagctggttt caacagcacg tcttgccggt       600
     atgtcggaag tggccacctc gatacttcat aatgtgggca atatattaaa cagcgtcaat       660
     gtttctgcca ttattctgaa aaagaatata tccaaaattc attataaaaa actgtccgct       720
     ataaaaacca tgcttgacga aaacatcaat caattaagcg aatacttgtt aaataatcca       780
     aaaggtaaat tagttcttcc ctatttggac gcgttatcga aaaccctgca tgaagagtat       840
     gaagaaaaca tgaaagaagc caatagtctg gaaactaaca ttaatcatat taaagaaatc       900
     atagccatgc agcaatcatt gagcggctta tcgaatttaa cagagaaaat ttcaatccat       960
     gatgtgattc ttaatgcggt aaaatcagtc atattggaca aacatcaaat tgatgtccgt      1020
     attgagattg aaccggatat caatgagttt atcactgata aatccaaatt gtttcaaatt      1080
     cttactaatt tactcgctaa tgcaaaagat tctgttttgt tacacgaagc gaatgcttcc      1140
     aggacaattg ttatttccat tgggagaact gaaaaaaatc atatcatgat taaaataaat      1200
     gataatggaa ttggaattca aaaagataac ctggatcgaa ttttctcttt tggatttaca      1260
     accaagaaaa atggtcacgg ttttggactg cactgttccg caatttatgc gagagatctg      1320
     ggtggtacac tttatgctga aagcaatggc aatggcgaag gagctcaatt tgtattagat      1380
     ttgcccatca atcccaaaac cttaagtccg aggtag                                1416
//

If you have problems or comments...

PBIL Back to PBIL home page