(data stored in ACNUC7421 zone)

EMBL: CP000675.HFLC

CP000675.HFLC        Location/Qualifiers
FT   CDS_pept        576959..577873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflC"
FT                   /locus_tag="LPC_2859"
FT                   /product="membrane protease subunit HflC"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2859"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56760"
FT                   /protein_id="ABQ56760.1"
FT                   /translation="MNAFKTTLGVLIFLVLVLLFTSMFTVTQGQQGIILRLGRLVKDPQ
FT                   TDAVKVLNPGLHFKTPFIESVRIFDTRIQTMDIKSTRIVTKEKKDVMVDYYVKWRISDL
FT                   AQYFKSTGGNEFKAETLLEQQLNTLLRAQFGKRTISDAVSGGRDDVMEILRNAAEKQAG
FT                   ELGIKVVDVRIKGIELPSNTSNAIYQRMRADMQKIANRHRADGQAAAEQIQAKADADVT
FT                   VLLAKTNSNAQRIRAVGEAEAAAIYSKAYTQNPDFFALYKSLLAYEASFHSKKDILILD
FT                   QSSSFFDYFKQAMPKNDGTAAKK"
     atgaatgcat ttaaaacgac attgggtgtc ttaatctttt tagtgctagt gcttttgttt        60
     accagtatgt ttactgtgac acaaggacag cagggtatta ttttacgttt aggacgtttg       120
     gtaaaagacc ctcaaactga cgcggtgaaa gtgttaaatc ctgggctcca ctttaaaacc       180
     ccttttatcg aaagtgtgcg aattttcgat acacgcatcc aaaccatgga tatcaaatcg       240
     acccgtattg tgaccaaaga gaaaaaagat gtcatggttg actattatgt gaaatggcga       300
     atttcagatt tggctcagta ttttaaatca acaggtggaa atgaatttaa agctgaaact       360
     ttgctagaac aacagttaaa taccttgctc agagctcaat ttggtaagcg taccatatcc       420
     gatgctgttt caggagggcg tgatgatgtt atggaaatac tgcgtaatgc tgctgagaag       480
     caagctggtg aattaggtat taaagtggtt gatgttcgta ttaaaggtat tgaattgcct       540
     tcaaatacca gtaatgccat ctatcaacgc atgagagctg acatgcaaaa aattgcaaac       600
     agacatagag ctgatggaca agctgccgca gaacagatcc aggcaaaagc tgatgctgat       660
     gtcacggttt tattggctaa aactaatagt aatgctcagc gaattagagc agttggtgaa       720
     gcggaagcag cggctatcta ttccaaagca tacactcaaa atcctgattt ttttgcatta       780
     tacaaaagct tgttagccta tgaagccagt tttcatagta aaaaagatat tttaatattg       840
     gatcaaagca gttcattttt tgattatttc aaacaagcta tgccaaaaaa tgatggtaca       900
     gcggctaaaa agtaa                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page