(data stored in ACNUC7421 zone)

EMBL: CP000675.HFLK

CP000675.HFLK        Location/Qualifiers
FT   CDS_pept        575814..576956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflK"
FT                   /locus_tag="LPC_2860"
FT                   /product="protease subunit HflK"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2860"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56761"
FT                   /protein_id="ABQ56761.1"
FT                   /translation="MGWNEPEKGKDPWSGKNQPPDLDEALKRIQDKLKKTFFGGTGKSN
FT                   NNSSGGSSGGLLAVTVLLIAFILWALSGIFIVDPAEQAVILRFGKYAETVGPGPHWIPR
FT                   FISSKIVMNVDRVLDYSYSAQMLTSDENLVSVSLAVQYRINDLSEYLFNVANPEESLQQ
FT                   ATSSALRQVVGTTTLDQIITEGREVWGGRVQETLTKTLESYKTGILIVNVSPQPARAPE
FT                   SVQDAFDDAIKAQEDEKRFKEQAYAYAAKVVPIAEGKASRIQQEAEAYSKQVVLRAQGE
FT                   VAEFLALLPQYNAAPQVTAKRMYLEAMQKVMNKSSTIIVDSKAGNLLYLPLDKLLGNQY
FT                   VQQSGNLKAIKNGANVSNEEDNLILSGRDLTRPTYSQGRD"
     atggggtgga atgagccaga gaagggcaaa gatccatggt cgggtaaaaa tcaacctccg        60
     gatttggatg aagctcttaa acgtatccag gataaattga agaaaacatt ttttggaggc       120
     acgggcaaat cgaataataa ttcgtcaggc ggttccagtg gcggattgct tgctgtcaca       180
     gttttattaa tagcttttat tctttgggct ctttctggta tttttattgt ggatcctgca       240
     gagcaagctg tgatactccg ctttggtaaa tatgcagaaa cagttggtcc tggtcctcat       300
     tggattcctc gttttatctc atcaaagatt gttatgaatg tggatagggt gctagattac       360
     tcctactccg ctcaaatgct taccagtgat gaaaatttag tatcggtctc tttggctgtc       420
     cagtaccgca ttaatgattt gagtgagtat ttgtttaatg tcgcaaatcc tgaggaaagc       480
     ttacaacagg caacttccag cgctttaagg caggttgtag gtacgacaac cctggatcag       540
     ataataactg aaggtcgaga agtttgggga ggtagagtac aagaaactct gacgaaaact       600
     ttagaaagct ataagaccgg aattttaatc gttaatgtgt caccccaacc tgccagagct       660
     ccagaaagtg ttcaggatgc ttttgatgac gcgattaaag ctcaagaaga tgaaaaacgt       720
     ttcaaggaac aggcttatgc ttatgcagca aaagtcgtgc ccattgcaga aggtaaagca       780
     agtcgtattc aacaggaagc ggaagcttat tcaaagcaag tcgttttaag ggcacaggga       840
     gaagtagcgg agtttttagc cttacttcct caatacaatg cagctcctca agttacggct       900
     aaacggatgt accttgaagc catgcaaaaa gtaatgaata agagcagtac gattattgtt       960
     gacagtaaag caggaaattt attgtatcta cctttagata aactacttgg taatcaatac      1020
     gttcagcaat ctggaaatct aaaagccata aaaaacggtg cgaatgtcag taatgaggag      1080
     gacaacttga ttctttctgg aagagatctc acaagaccaa cttatagtca agggagagat      1140
     tga                                                                    1143
//

If you have problems or comments...

PBIL Back to PBIL home page