(data stored in ACNUC7421 zone)

EMBL: CP000675.HFQ

CP000675.HFQ         Location/Qualifiers
FT   CDS_pept        13054..13311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hfq"
FT                   /locus_tag="LPC_0010"
FT                   /product="host factor-I protein for bacteriophage Q beta
FT                   replication"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54010"
FT                   /db_xref="GOA:A5I9G0"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5I9G0"
FT                   /protein_id="ABQ54010.1"
FT                   /translation="MSKNHLLQDPFLNELRKEKVPVSVFLVNGIKLHGIIDSFDQYVVM
FT                   LKNSITQMVYKHAISTVVPSRMVKIPAEESSGEEEGTVAD"
     atgtctaaaa atcatttact acaagaccct ttcctaaatg aattgcgcaa ggaaaaggta        60
     cctgtttcag tgttcctggt caatggtatt aaattgcatg ggataatcga ttcttttgat       120
     caatatgtgg tgatgcttaa aaactccata acccaaatgg tttataaaca cgccatttca       180
     acagttgttc cttctcgaat ggtcaaaatt cctgctgagg aaagctctgg tgaggaagaa       240
     ggaactgtgg cagactaa                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page