(data stored in ACNUC7421 zone)

EMBL: CP000675.HSLU

CP000675.HSLU        Location/Qualifiers
FT   CDS_pept        776208..777551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslU"
FT                   /locus_tag="LPC_2652"
FT                   /product="ATP dependent Hsl protease, ATP binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2652"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56566"
FT                   /protein_id="ABQ56566.1"
FT                   /translation="MMKANNMVMTPREIVQELDKHIIGQDDAKRAVAIALRNRWRRMKI
FT                   KDPVLRNEIMPKNILMIGPTGVGKTEIARRLANLAKAPFIKVEATKFTEVGYVGRDVDS
FT                   IIRDLTDMAIKQEREFAMKKVEHLAEDAAEERILDVLLPPARGTLTPGEKNTTARQVFR
FT                   KQLREGELNDNEIEIEVAATPVGIEIMAPPGMEEMTSQLQSMFQQVGSYRTKTRKMTVA
FT                   KAMKILREEEAAKLINEEDIKLKAIESVEQNGIVFIDELDKIAKRSDTVSGGDVSREGV
FT                   QRDLLPLVEGTTVSTKYGMVKSDHILFIASGAFHVAKPSDLIAELQGRLPIRVELSALS
FT                   VEDFVRILTEPSASLTLQYSALMETEGLTLTFDETGIRRIAEVAWQVNERTENIGARRL
FT                   YTVMERLLEVVSFEATDKAGETVHVDKAYVDKNLGQLIADEDLARYIL"
     atgatgaagg caaataatat ggtcatgacc cctcgagaga tagttcaaga attagataag        60
     cacattattg gtcaagatga tgcaaaacgt gccgtagcca ttgcattacg aaatcgttgg       120
     cgtcgaatga aaatcaaaga tccagtattg cgcaacgaga taatgcctaa aaatattttg       180
     atgataggcc ctaccggtgt tggtaagacg gagattgcaa gacgtttggc taatttggct       240
     aaagctccat ttattaaagt agaagcaacc aaattcacgg aagtgggata tgtggggcgt       300
     gatgttgatt cgatcattcg tgacttaaca gatatggcaa tcaagcaaga gcgtgaattt       360
     gccatgaaaa aagtggagca cctggcagaa gatgcggctg aagaacgaat cctggatgtt       420
     ttactccctc ctgctcgagg aacattaact cctggtgaga aaaacacgac agctcgtcaa       480
     gtgtttcgta agcaattacg cgaaggtgag cttaatgata atgaaattga aattgaagta       540
     gcagcaacgc ctgttggcat tgaaattatg gctcctccag gtatggaaga gatgactagc       600
     caattgcagt ctatgtttca acaagttgga agctacagaa cgaaaactcg aaaaatgacc       660
     gttgccaagg caatgaaaat tttgagagag gaagaagcgg caaaattaat taacgaagaa       720
     gatatcaagt taaaagcgat tgaaagtgtt gagcaaaatg gaatagtgtt cattgatgag       780
     ttggataaaa ttgccaaacg ctccgatact gtaagtgggg gagatgtatc acgtgagggt       840
     gttcagcgag atttattgcc attagttgaa ggaactaccg tttcaacaaa atacggcatg       900
     gtaaaatccg atcatatttt attcattgct tcaggtgctt ttcatgtagc taaaccttct       960
     gacttgattg ctgaattgca agggcgtctg ccgatacgtg tcgagttgtc agccctctct      1020
     gtggaagatt ttgtacgaat ccttactgag ccaagcgcct ctttaacttt acagtattcc      1080
     gctttgatgg aaaccgaagg attgactctt acctttgatg aaacaggaat tcgacgtatt      1140
     gctgaagtag cctggcaagt gaatgagcgt acggaaaata tcggagcaag aagattatat      1200
     accgtcatgg aacgcttact ggaagtggtt tcatttgaag cgactgataa agctggcgaa      1260
     acagtgcatg ttgataaagc ctatgtcgat aagaatttag gccaactaat cgctgatgag      1320
     gatttggctc gctatatttt gtaa                                             1344
//

If you have problems or comments...

PBIL Back to PBIL home page