(data stored in ACNUC7421 zone)

EMBL: CP000675.HSLV

CP000675.HSLV        Location/Qualifiers
FT   CDS_pept        775676..776224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslV"
FT                   /locus_tag="LPC_2653"
FT                   /product="heat shock protein, HslVU, proteasome-related
FT                   peptidase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2653"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56567"
FT                   /db_xref="GOA:A5IGR7"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IGR7"
FT                   /protein_id="ABQ56567.1"
FT                   /translation="MEQFHGTTILSVRRGNQVVIGGDGQVTLGNTVMKGNARKVRRLYK
FT                   DKVIAGFAGGTADAFTLFERFEAKLEMHQGHLIRAAVELAKDWRTDRILRRLEAVLAVA
FT                   DSKASLIITGNGDVIEPEESLIAIGSGGPFAQAAARALMENTQLSAKEIVQKALTIAGD
FT                   ICIYTNNNLTIEELNDEGK"
     ttggaacaat ttcatgggac aacaatactt tcagtacgac gcggtaatca ggttgtcatt        60
     ggcggtgatg ggcaagttac tctaggtaat accgtgatga aaggcaatgc acgtaaagtt       120
     cggagattgt ataaagataa agtgattgct ggttttgcag gtggaacagc agatgctttt       180
     actcttttcg aacggtttga agcaaaactg gaaatgcatc aggggcattt gattagagca       240
     gctgttgaat tggctaaaga ttggcgaacc gatagaattc ttcgtcgatt agaggcagtt       300
     cttgcagtag cggatagcaa ggcttcttta attattaccg gtaatggcga tgtcattgag       360
     cccgaagaaa gtttaattgc aatcggctct ggcggtccct ttgctcaagc tgcagccaga       420
     gcccttatgg aaaacacaca gttatctgcc aaggagattg tccagaaagc tttaacaatc       480
     gctggcgaca tttgtattta tactaacaat aatttaacca tagaagaatt aaatgatgaa       540
     ggcaaataa                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page