(data stored in ACNUC7421 zone)

EMBL: CP000675.HTPB

CP000675.HTPB        Location/Qualifiers
FT   CDS_pept        849465..851111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpB"
FT                   /locus_tag="LPC_2606"
FT                   /product="Hsp60, 60K heat shock protein HtpB"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2606"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56521"
FT                   /db_xref="GOA:A5IGM1"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IGM1"
FT                   /protein_id="ABQ56521.1"
FT                   /translation="MAKELRFGDDARLQMLAGVNALADAVQVTMGPRGRNVVLEKSYGA
FT                   PTVTKDGVSVAKEIEFEHRFMNMGAQMVKEVASKTSDTAGDGTTTATVLARSILVEGHK
FT                   AVAAGMNPMDLKRGIDKAVLAVTKKLQAMSKPCKDSKAIAQVGTISANSDEAIGAIIAE
FT                   AMEKVGKEGVITVEDGNGLENELSVVEGMQFDRGYISPYFINNQQNMSCELEHPFILLV
FT                   DKKVSSIREMLSVLEGVAKSGRPLLIIAEDVEGEALATLVVNNMRGIVKVCAVKAPGFG
FT                   DRRKAMLQDIAILTKGQVISEEIGKSLEGATLEDLGSAKRIVVTKENTTVIDGEGKATE
FT                   INARIAQIRAQMEETTSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDAL
FT                   HATRAAVEEGIVAGGGVALIRAQKALDSLKGDNDDQNMGINILRRAIESPMRQIVTNAG
FT                   YEASVVVNKVAEHKDNYGFNAATGEYGDMVEMGILDPTKVTRMALQNAASVASLMLTTE
FT                   CMVADLPKKEEGVGAGDMGGMGGMGGMGGMM"
     atggctaaag aattacgttt tggtgatgac gctcgcctac aaatgcttgc tggtgttaat        60
     gcattagcag atgcggttca agttactatg ggtccacgtg gccgtaatgt tgtattggaa       120
     aaatcttatg gcgctcctac tgtaactaaa gacggtgtgt ctgttgccaa agaaattgaa       180
     tttgagcatc gtttcatgaa catgggcgct caaatggtta aagaagtggc ttctaaaact       240
     tctgatactg ctggtgatgg tactactact gcaacagtat tggctcgttc tattcttgtt       300
     gaaggtcaca aagcagttgc tgctggtatg aatccaatgg atctcaaacg cggtattgat       360
     aaagcagtat tagcagttac caaaaaatta caagctatgt ctaagccatg caaagacagc       420
     aaagctattg ctcaagttgg aactatttct gctaattctg atgaagcgat tggtgctatc       480
     attgctgaag caatggaaaa agttggtaaa gagggtgtta ttaccgttga agatggtaat       540
     ggattggaaa atgagctttc tgttgttgaa ggtatgcaat ttgatcgcgg ttacatttct       600
     ccatacttca tcaacaacca gcaaaacatg agctgtgaac ttgagcatcc attcatttta       660
     ttggttgaca aaaaagtttc cagtattcgt gaaatgttgt ccgtattgga aggtgttgca       720
     aaatctggcc gtcctttatt gatcatcgca gaagatgttg aaggcgaagc tttagctact       780
     ctggtagtta acaacatgcg cggtattgta aaagtatgtg ctgtcaaagc gcctggtttt       840
     ggtgatcgtc gcaaagcgat gctgcaagac attgctattt tgactaaagg tcaagtgatt       900
     tctgaagaaa ttggcaagag cctggaaggt gctactctgg aagatcttgg tagtgctaag       960
     cgaatcgttg ttaccaaaga aaacaccact gtcattgatg gtgaaggaaa ggcaactgaa      1020
     attaatgctc gtattgctca aattcgtgca caaatggaag aaaccacttc tgattacgat      1080
     agagaaaaat tacaagagcg cgttgctaag ttagctggtg gtgttgctgt tatcaaagtt      1140
     ggcgctgcca cagaagttga aatgaaagag aagaaagcac gtgttgaaga tgctcttcat      1200
     gctactcgcg ctgcagtaga agaaggtatc gttgccggtg gtggcgttgc cttgattcgt      1260
     gctcagaaag ctcttgattc attgaaaggc gataatgacg atcaaaatat gggtatcaat      1320
     attttacgtc gcgctattga atctccaatg cgtcaaattg ttactaacgc aggatatgaa      1380
     gcttctgttg tagtaaacaa ggtagctgag cacaaagaca actatggttt caacgctgca      1440
     actggtgaat acggtgatat ggttgagatg ggtattcttg atccaaccaa agtaacccgt      1500
     atggctctgc aaaatgcagc ttctgtagcc agtttgatgt tgactactga atgtatggtt      1560
     gctgatctgc ctaagaaaga agaaggtgtt ggtgccggcg atatgggcgg catgggcgga      1620
     atgggtggca tgggcggaat gatgtaa                                          1647
//

If you have problems or comments...

PBIL Back to PBIL home page