(data stored in ACNUC7421 zone)

EMBL: CP000675.LIDJ

CP000675.LIDJ        Location/Qualifiers
FT   CDS_pept        complement(500177..500725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lidJ"
FT                   /locus_tag="LPC_2936"
FT                   /product="inner (transmembrane) protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2936"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56837"
FT                   /protein_id="ABQ56837.1"
FT                   /translation="MNKQMQWHLFGNTSGLLIICCLLILAFLDQFIFYELPCPICILQR
FT                   ICFVAVGLCFVMNLMLGIRASHYGLMLLASLLGLSISVRQMYIHLTPGDPGYGGLFLGL
FT                   HLYTWSAIIFLVIILLIAGALILDKGFMPDYKVRSKSAKVMIWVFFILILANGISTFLE
FT                   CGPHECPDNPSKYYLLNNN"
     atgaataaac aaatgcaatg gcatcttttc gggaatactt cgggcttatt gataatttgt        60
     tgccttttga tcttggcctt cctggatcaa ttcatctttt atgaactacc ctgccctata       120
     tgcattttgc aaaggatttg ctttgttgca gtaggtctct gttttgttat gaatttaatg       180
     ctgggtatta gagcttcaca ttacgggctg atgcttttgg caagtctttt agggctgtct       240
     atctcggttc ggcaaatgta tattcattta acacctggtg atcctggtta tggcggcctc       300
     tttttgggtt tacatcttta cacttggtca gcaatcatat ttttagtcat tatcttatta       360
     attgctgggg ctctaatcct tgataagggc ttcatgccag attataaagt acgaagcaag       420
     tcagcaaaag taatgatatg ggtatttttt atcttgattc ttgccaatgg aatcagtaca       480
     ttcttggaat gtggaccgca cgaatgtcca gataacccga gcaaatatta tttactaaat       540
     aataattaa                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page