(data stored in ACNUC7421 zone)

EMBL: CP000675.LPXA

CP000675.LPXA        Location/Qualifiers
FT   CDS_pept        603192..603962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxA"
FT                   /locus_tag="LPC_2835"
FT                   /product="acyl-(acyl carrier
FT                   protein)-UDP-N-acetylglucosamine acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2835"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56736"
FT                   /protein_id="ABQ56736.1"
FT                   /translation="MIDERAMIHPSAKLASGVSIGPGTVIGADVEIGENTWIGPHVVIE
FT                   GPTVIGKNNKIFQFASVGDEPQDITYKGEPTRLEIGDNNVIREYCMISRGTVKGGGVTR
FT                   IGNSNYLMAYSHIGHDCMVGNHIIMVNYAALSGHVTINDYAIIGPYAAVHQFCQVGAYA
FT                   FIARATYVTKDVLPYVMIAGHTTSACGINTVGLRRRGFSSAAIDCLRRAYKIIFRKGLT
FT                   VQQAVSELELIQNECPEIIPMIDALNQSTRGIVR"
     gtgatagatg aaagagcaat gattcaccca tcggcgaagc tggcaagtgg agtgtcaata        60
     ggccctggaa cagtgatagg cgctgatgtt gagattggtg aaaatacctg gatagggccg       120
     catgtagtaa ttgaaggacc tactgtaatt ggtaaaaaca ataagatctt tcaatttgct       180
     tccgtaggag atgagccaca agatatcact tataagggcg agccaactcg tcttgaaatc       240
     ggcgataata atgtaatcag agaatattgc atgattagcc gaggtactgt caaaggtgga       300
     ggtgtcactc gcattggcaa tagcaattat ttaatggctt attcacatat tggccatgat       360
     tgtatggtag gcaatcatat tattatggtc aattatgcag ccttatcagg tcatgtcaca       420
     attaatgatt acgcaattat cggcccttat gctgcagttc accaattttg tcaggtggga       480
     gcctacgcct tcatagcccg agctacctat gtcactaaag acgtattgcc ctatgttatg       540
     attgcaggtc ataccacttc tgcttgtgga atcaacactg ttggtttaag aaggagaggt       600
     ttttcttctg ctgcgattga ttgtttgcga cgcgcatata aaattatctt tcgcaaaggg       660
     ttaaccgttc aacaggcagt ttcagaatta gagttgattc aaaatgagtg tccagaaatt       720
     attcctatga ttgatgcttt gaatcaatcc acaagaggca ttgtgaggta a                771
//

If you have problems or comments...

PBIL Back to PBIL home page