(data stored in ACNUC7421 zone)

EMBL: CP000675.LVGA

CP000675.LVGA        Location/Qualifiers
FT   CDS_pept        657116..657742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lvgA"
FT                   /locus_tag="LPC_2777"
FT                   /product="hypothetical virulence protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2777"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56680"
FT                   /protein_id="ABQ56680.1"
FT                   /translation="MADGDIEIKAGFVDTDLDDRKLTMIDDLNNPLAIVERVYLIWWHW
FT                   ADFHLHVISPHIDTITPAIVIEPELISGSNEHEFVYSIHDSGSKLSTSKSQDMFSAGMS
FT                   MCKLFYTIEKMVHILVDRLKSGGVSMEEEVQIAFAGHEIAQRKAFESIINLPYNVVVTN
FT                   FDPGIWGEKYLQNVKRLADKGYGYPPESPRENYKHPVSSATTARK"
     atggcagacg gcgatatcga aatcaaagca ggtttcgtag atactgatct agacgatcgc        60
     aaactgacaa tgatagatga tttgaataat ccattagcga tagtggagcg agtctatctg       120
     atatggtggc attgggcaga ttttcatctt catgttattt ctccacatat tgatactatt       180
     actcctgcga tagtcatcga acccgaactg atatctggtt ctaatgagca tgaatttgtt       240
     tattccattc atgatagtgg ctctaaatta tctacatcca aaagccagga tatgtttagt       300
     gcgggcatgt ctatgtgcaa acttttttat actattgaaa aaatggttca tattctggta       360
     gatcgcttaa aatctggcgg tgtcagtatg gaggaagagg ttcagatagc ttttgctggc       420
     catgaaatag cccagagaaa ggcttttgag tcaattatta atttacctta taatgttgtt       480
     gtgactaatt ttgatcccgg aatatggggt gaaaaatatt tacaaaatgt gaaacgcctg       540
     gcggataaag ggtatggtta tcctcctgaa tccccaagag aaaattataa gcatccggta       600
     tcttctgcaa ctactgcacg aaaataa                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page