(data stored in ACNUC7421 zone)

EMBL: CP000675.LVRA3

CP000675.LVRA3       Location/Qualifiers
FT   CDS_pept        617842..618723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lvrA3"
FT                   /locus_tag="LPC_2815"
FT                   /product="Legionella vir region protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2815"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56716"
FT                   /protein_id="ABQ56716.1"
FT                   /translation="MDMLINQDELAAMSGLPHIQQLAYLRGIRPYMDVKTGITGIKRRI
FT                   SYQSISEQLYIEPHQGIKSQSFSRDQVRRAVSGLVRAGMIEVQSDGMQLILKCPLASRH
FT                   YSAQNKAAINPPQKATIKPHVETLVNNEFSEGEAIKADIAEPQKAAIPLKDNNYIYLLS
FT                   RFEQFWNLYPEKKSHERAFEAFRKISPDEHLLRMMLQALENQIKARNVKIAHGEWVPPW
FT                   KYPSNWLVQKCWEDEVKIEVTQEKRNAKRHPNTELTTVDPFWNPEGEDTASTSEDEYEQ
FT                   SNVINLRCYRQQ"
     atggacatgt taataaacca ggatgaactg gcagcaatga gtggcttacc tcatatccag        60
     caattggctt atctaagagg aatcagaccg tatatggatg ttaaaacagg aataacaggt       120
     atcaagcgac gaatcagcta tcaatcgata tctgaacaat tatatatcga gccacatcag       180
     gggattaaaa gccaaagctt ttctcgtgat caagtacgtc gtgcagtttc aggtttggta       240
     cgtgcgggaa tgattgaagt tcaatctgac ggcatgcagc tcattttaaa atgtccctta       300
     gcttcaaggc attattctgc ccaaaataaa gccgccataa acccgccaca gaaagccacc       360
     ataaagccgc acgtggaaac ccttgtaaac aatgagtttt ctgaaggtga ggccataaaa       420
     gccgacatag ctgaacccca aaaagccgcc atacctctta aagataataa ttatatttat       480
     ttattaagcc gcttcgaaca attttggaat ttataccccg agaaaaaatc ccacgagcgt       540
     gcttttgaag ccttcagaaa aatcagccct gacgagcatc tattgcgaat gatgttgcaa       600
     gcactggaaa accaaatcaa agcacgaaat gtaaaaatag cccacggcga atgggtgcca       660
     ccctggaaat atccaagcaa ctggttggtt caaaaatgct gggaagatga agtcaaaatc       720
     gaagtaacgc aggagaaaag gaatgcaaag cgccacccaa atactgaact cacaaccgtt       780
     gatccattct ggaacccaga aggagaagac acagcaagca ccagtgaaga cgagtacgaa       840
     caaagcaatg tcatcaacct gcgatgctac cgacagcaat aa                          882
//

If you have problems or comments...

PBIL Back to PBIL home page