(data stored in ACNUC7421 zone)

EMBL: CP000675.LVRB3

CP000675.LVRB3       Location/Qualifiers
FT   CDS_pept        618740..619048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lvrB3"
FT                   /locus_tag="LPC_2814"
FT                   /product="Legionella vir region protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2814"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56715"
FT                   /protein_id="ABQ56715.1"
FT                   /translation="MFTRFAVFYGHLWRSQFKSDGFLEFAKKEWMAGLSKFSDDVLNQA
FT                   IVECRDFCEMPPSLPQLIRICRDIKKRNNVYVTPEEVAPASAEVAEANIKQCKAFLF"
     ttgtttacgc gctttgcagt tttttatggg catttgtggc gcagtcagtt caaaagcgat        60
     gggtttttgg agtttgccaa aaaggaatgg atggcggggt taagcaagtt tagtgatgac       120
     gttttgaatc aagccatcgt ggagtgtcgt gatttttgtg aaatgccgcc aagcttgcct       180
     caactgattc gcatttgtcg tgacataaaa aaacgaaata acgtttatgt cacgcctgaa       240
     gaagttgctc ctgcgagtgc cgaagtggcg gaagcgaata ttaagcaatg taaagcattt       300
     ttattttaa                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page