(data stored in ACNUC7421 zone)

EMBL: CP000675.NIFU

CP000675.NIFU        Location/Qualifiers
FT   CDS_pept        733265..733714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifU"
FT                   /locus_tag="LPC_2694"
FT                   /product="nitrogen fixation protein (Fe-S cluster
FT                   formation) NifU"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2694"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56606"
FT                   /protein_id="ABQ56606.1"
FT                   /translation="MSMELRELYQEIIIDHNRNPRNHHAMEDATTEAKGFNPLCGDKLT
FT                   VYLKLQGDLIRDVSFIGCGCAISQASASLMTDALKGKSIKEAHELFHRVHRMLTQEEED
FT                   SLVSMDKLTVLAGVKAFPARVKCATLAWHTLEAALNKETEVVKTE"
     atgagtatgg agttgcggga actttaccag gaaatcatca tcgatcacaa tcgtaatcct        60
     cgtaaccacc atgcgatgga ggatgcgacc accgaggcga aggggtttaa ccctttatgc       120
     ggagataaac tgactgttta cctcaagttg cagggtgatt tgattcgtga tgtcagtttt       180
     attggatgtg gctgtgctat ctcacaagct tctgcatcgt taatgaccga tgcgttaaag       240
     ggtaaatcaa ttaaagaagc tcatgaacta tttcatcgtg ttcatcgaat gctaacacaa       300
     gaggaagaag attctttggt ttccatggat aaattaacag ttctagccgg agttaaagca       360
     ttccctgcgc gtgtaaaatg cgccactttg gcgtggcata ctttggaagc agctttaaac       420
     aaagaaacag aagtggtgaa aacagaataa                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page