(data stored in ACNUC7421 zone)

EMBL: CP000675.OPRM

CP000675.OPRM        Location/Qualifiers
FT   CDS_pept        519460..520803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oprM"
FT                   /locus_tag="LPC_2914"
FT                   /product="outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2914"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56815"
FT                   /protein_id="ABQ56815.1"
FT                   /translation="MLKKLMFLLLLGAGLLSCGQSTDQQISNIITPKQFPSSPRDYRPV
FT                   QELPYLAWWKQFQDPELDRLIDTGLKTNMDIHIAMANLQQAQGELQQVKLSWIPNVQIL
FT                   GGYSTNPALGVPGGFYGIWPSYILNIMQLYTQQKRAQYQVQYHQAAIDGLRLTLIGQVA
FT                   AAYFTLIAQLEQLKLLYKLDRDLKSLIALSRKEINIGLKNDIDLAQLQSNERLIAAQIK
FT                   PIKHNIVVSQNALRYLINENPGLIKSKNNFAQLDFTRFKPGSLPASVLSNRPDMKMAEY
FT                   SLKAARAGIFVAYSDFFPVMQLDDFIGEAHLPDSTFEQATDAYVNWTINPNTLGKISVS
FT                   KGVYNAKLAEYVKTIRLILKEVDNAFSANKRMREQFLSYRHAQEDYQHKYKLQNGLLKS
FT                   GLMSYKELLESKVYLDTLALSTNQAKLELAMSLVMLYQDLAGGYACSD"
     atgcttaaaa aattaatgtt cttattattg ttgggagcag gtttgttaag ctgtggtcaa        60
     agcactgatc agcaaatttc caatattata acgccgaagc aattcccctc cagtcccagg       120
     gattatcgac cagttcagga gttgccttat ttggcctggt ggaagcaatt tcaggatcca       180
     gaattggatc gtttaattga tactggattg aagaccaata tggatattca tattgcaatg       240
     gctaatttac agcaagctca aggagagtta cagcaagtga agttgagttg gatacctaat       300
     gttcaaatat tgggagggta ttcaactaat cctgctcttg gtgtgccagg agggttttat       360
     ggaatatggc caagttatat tttgaatatt atgcaacttt atactcagca aaagcgtgct       420
     caatatcagg tccaatatca tcaggcagca atcgatggtt tgcgtttgac cttgattggt       480
     caggtggcag cggcttattt cactttgatt gcacagttgg agcaacttaa attattgtat       540
     aaactggata gggatttaaa gtcgttaatt gctttgagca ggaaagaaat caacatagga       600
     ttaaaaaatg atattgattt ggctcagttg caatccaacg agcgcttgat tgcagcacaa       660
     ataaaaccca ttaaacacaa cattgtcgtt agtcagaatg cgttgcgtta tttaataaat       720
     gagaatcctg gtttaatcaa aagcaaaaat aattttgctc aattggattt tacccgcttt       780
     aaaccaggaa gtttacccgc tagcgtatta agtaatcgcc ctgatatgaa gatggcggag       840
     tattccctaa aagcggctcg tgcaggtatt tttgttgctt atagtgattt ttttcctgtt       900
     atgcagctgg atgattttat tggagaggca catttgcctg atagcacgtt tgaacaagcg       960
     accgatgcgt acgtaaactg gacaattaat cccaatactc tgggtaaaat ttcagttagc      1020
     aagggagttt ataatgcaaa attggccgaa tacgttaaga caatccgatt aattttaaaa      1080
     gaagttgata atgctttttc agctaataag cgcatgagag agcaattttt atcttatcgg      1140
     cacgcacaag aagattatca gcataaatac aaattacaaa atggtttatt aaaatcaggg      1200
     ttaatgtcct ataaagagtt attggagagt aaggtttatc tggataccct ggcgctctca      1260
     acaaatcagg ctaagctgga attggccatg tcactggtta tgttgtatca agatttggct      1320
     ggtgggtatg cctgtagtga ctaa                                             1344
//

If you have problems or comments...

PBIL Back to PBIL home page