(data stored in ACNUC7421 zone)

EMBL: CP000675.PARE

CP000675.PARE        Location/Qualifiers
FT   CDS_pept        complement(854188..856068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parE"
FT                   /locus_tag="LPC_2603"
FT                   /product="DNA topoisomerase IV subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2603"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56518"
FT                   /protein_id="ABQ56518.1"
FT                   /translation="MSENYTAEAIEVLSGLEPVQRRPGMYTDTTRPNHLAQEVIDNSVD
FT                   EVLAGFASRIIVTLHEDGSIEVEDDGRGMPVDLHPQLGLSGVEVIMTRLHAGGKFSDKN
FT                   YSFSGGLHGVGVSVVNALSERLDVTIKRNGIIYQMTFANGDKLCELNETGVTKKRETGT
FT                   VIRFWPNGKYFDTTKISVKHLTHVLRAKAVLCSGLSMTFINKITNEEMNWCYEQGLTDY
FT                   LQQTLPEDYLPEEPFAGAFKSDEATVDWALAWSDSANGNLNESYVNLIPTIQGGTHVNG
FT                   LRSGLFEAMSEFCELRNLLPRGVKLTADDLWESCQYVLSIKMKEPQFAGQTKERLSSRQ
FT                   TSGLVSNVIKDAFAIWLNQHRNQGEAIAALAIERAQKRLKQAKQVARKRVSQGPALPGK
FT                   LADCLQTDLSQAELFLVEGDSAGGSAKQARNKDYQAILPLRGKILNSWEVDSSQVLASQ
FT                   EIHDISVAIGVDPGSSDLEGLRYGKICILADADSDGAHIATLICALFLRHFKPLVKAGH
FT                   VFVAMPPLYRIDAGKLIHYALDDEEKNRIIQHLSQTTKSKVNVQRFKGLGEMNPIQLRE
FT                   TTMDPNTRRLVQLTLDDEEQTEAIMDMMLNKKRAADRKLWLETKGNLAEI"
     atgtcagaaa actacactgc ggaagcgatt gaagtcttaa gtggtcttga gcctgttcaa        60
     cgacgtcccg gtatgtatac cgacacgaca cgccccaacc atttggctca ggaagtgatt       120
     gataatagcg tcgatgaagt acttgctgga tttgccagcc gtattattgt tactttacat       180
     gaagacggct ctattgaagt cgaggatgat ggccgaggta tgccagtcga tttgcatcct       240
     caactgggct taagtggtgt cgaggtcatt atgactcgac ttcatgccgg aggtaagttt       300
     tcagataaaa attacagctt ttctggcggc ttgcatggcg ttggggtgtc cgtggtaaat       360
     gccttgtcag aacgactgga cgtcaccata aagcgcaatg ggatcattta tcaaatgacc       420
     tttgctaatg gcgacaaatt atgtgaatta aatgaaaccg gggttacaaa aaaaagagag       480
     accgggactg ttatacgttt ttggcctaat ggcaaatatt ttgacactac aaaaatttct       540
     gtaaaacacc tgactcatgt attaagagca aaagcggtat tgtgtagtgg cttgtccatg       600
     acctttatca ataaaatcac taatgaagaa atgaactggt gttatgagca aggtttaact       660
     gattatttac agcaaacctt gcccgaagac tatttgcctg aagaaccttt tgccggagca       720
     ttcaaaagtg atgaagcaac tgttgattgg gctttggcct ggtcagactc tgccaatggc       780
     aatttaaatg aaagttatgt gaatttaatc ccgacaatac aaggtggcac gcacgtcaat       840
     ggattgcgtt cgggattatt tgaagccatg tctgaatttt gtgagctgag aaaccttctt       900
     cctcgtggag taaaattgac agcggatgat ctatgggaat catgccagta tgttttatca       960
     atcaaaatga aagagccgca atttgcgggg caaaccaaag agcgcttgag ttcacgccaa      1020
     acctcaggac tagtcagtaa tgtcataaaa gacgcttttg caatttggtt gaatcagcat      1080
     cgcaaccagg gtgaagctat agcagctctc gcaatagaac gcgcacagaa acggctaaag      1140
     caagccaaac aagtggcacg caaacgtgtt agccaagggc ctgctttacc tggaaaatta      1200
     gccgattgct tgcaaacgga cttaagtcaa gcggaactat tcctggttga aggagattcg      1260
     gcaggagggt cggccaaaca agcccgcaat aaagattatc aagccatttt acctttacgt      1320
     ggaaaaatac ttaattcatg ggaagtagat tcttcacaag ttctggcatc ccaggaaatt      1380
     catgatatat ctgttgctat aggtgtagac cctggctcca gcgatctcga gggtcttcgc      1440
     tatgggaaaa tctgtattct cgctgatgca gactctgatg gagctcatat tgccacacta      1500
     atatgtgctt tgtttttaag acacttcaaa cctctggtta aagcaggcca tgtttttgta      1560
     gccatgcccc cgctctatcg aatcgatgca ggtaagctga ttcactatgc cctggatgat      1620
     gaagaaaaaa atagaatcat tcaacatctc agtcaaacca caaaatcaaa agtgaatgta      1680
     cagcgattca aaggattagg tgaaatgaat cccattcagc ttagagaaac cacaatggac      1740
     cccaatacaa ggcgtctggt acagcttact cttgatgatg aagagcagac ggaagccatt      1800
     atggatatga tgctcaacaa aaaaagggcc gccgacagaa aactctggct agaaacaaaa      1860
     ggaaaccttg ctgaaatttg a                                                1881
//

If you have problems or comments...

PBIL Back to PBIL home page