(data stored in ACNUC7421 zone)

EMBL: CP000675.PE101

CP000675.PE101       Location/Qualifiers
FT   CDS_pept        complement(100651..101598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0102"
FT                   /product="glutathione synthase/ribosomal protein S6
FT                   modification enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54101"
FT                   /protein_id="ABQ54101.1"
FT                   /translation="MINLFRRLKNHGVLSINQRNTDFVLRYNPRKLFPLVDDKLKTKKL
FT                   ALKAGIAVPALYDIIETEQQIKSIETRFASYNDFVVKPARGSGGDGILVFKDKVYGRYR
FT                   QINGKLTTVQELSYHLSCLLSGAYSLGGSSDYAIIEKRVVVDPVFAEVSYEGIPDIRII
FT                   TLLGYPAMAMVRLPTRLSGGKANLHQGAIGVGVDLATGKTLGGVFQNDTIDYHPDTLNP
FT                   IVGIEVPYWNQILEIASSCYELTGLGYLGVDIVLDKEHGPLMLELNARPGLNIQIANRE
FT                   GGLKRYRTIEARFKENGKESTLDKVNFCRKEFAR"
     atgattaacc tgtttaggcg cctgaaaaat cacggggttt taagcattaa ccagcggaat        60
     acggattttg tattacgata caatccaaga aagttatttc ctttggttga tgacaagctc       120
     aaaaccaaaa agctggcctt aaaagctgga attgcagttc ctgccttata cgacatcatt       180
     gaaactgagc aacaaatcaa atcaatagaa acccgatttg ccagctataa tgatttcgtg       240
     gtaaaaccgg ccagaggttc tggtggtgat ggaatactcg tatttaaaga taaagtttac       300
     ggtcgatatc gacaaattaa tggtaagctg actaccgtcc aggaactgag ttaccattta       360
     tcttgcttgt tatccggggc ctatagcctt ggcgggtcct cggattatgc catcattgaa       420
     aaacgagtgg tcgttgaccc ggtatttgct gaggtcagtt acgaaggcat acccgatata       480
     cgtattatta ccttattagg ctatccggca atggccatgg taagacttcc cacccgatta       540
     tccggcggaa aagccaactt acatcaagga gcaataggcg taggtgttga tcttgcaaca       600
     ggaaaaactc ttggcggcgt gtttcaaaat gataccatag actaccaccc cgacacgtta       660
     aatcccatcg taggcatcga agtaccttat tggaatcaga ttcttgaaat agcctccagt       720
     tgctatgagt taactggttt gggttatctt ggagttgata ttgtacttga taaagagcat       780
     ggtccattaa tgctggaatt aaatgccaga ccaggattaa atatacaaat agccaaccga       840
     gaaggtgggc ttaagcgcta tagaacaatt gaagcccgtt ttaaggaaaa tggcaaagaa       900
     tctactctgg acaaagttaa tttttgccgc aaagagtttg cgcgctaa                    948
//

If you have problems or comments...

PBIL Back to PBIL home page