(data stored in ACNUC7421 zone)

EMBL: CP000675.PE104

CP000675.PE104       Location/Qualifiers
FT   CDS_pept        103885..105816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0105"
FT                   /product="hypothetical protein conserved within
FT                   Legionellae"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54104"
FT                   /protein_id="ABQ54104.1"
FT                   /translation="MPHASDENQASKPTDLVFILAIAGRIDAQSRILAQKLDKSRSIYY
FT                   AYAVMDSLSSSYSMFKYFFDLFASPNDNDAMHEFLNSPTGLITIAVESVFLVTFSVLAC
FT                   QFENEKEDYYKKFIANAWPYFRDVMKGLKNAYKGWRSAVVAFSLIGGVDAKFLILPMGV
FT                   ILGVFAAANRFWIRSMLEDRKTMMSENIALLMEIKKLISLSHEESFSYFKRIRSQTMQT
FT                   RNFAFWAVAAGGLLDGLYLYVGVLSLAVLSPQLLMAMALICAFYTVACVITRIYEEYDF
FT                   QLRLLVTQTKCQLALITKELETNYAKLLLLQDKMDLDKADQEELKRLKRLVHNLITRFD
FT                   DSRKLLSQQSNRTYLSSALLGMKNGLYAYGALASVLFLVGSILVMAGVSFPPALLTACI
FT                   ILGLVLVLSFTIHSLVSNYWHQKKQETQKQRPYERLIEWNNCLNDEFNKTELLAPEEFN
FT                   KLLNDGLSLDPSPQFFFQEWFEVLRSLFSGFGKGQKFIDFAGNSLQELGEDGHYRDTPV
FT                   MYVLSVFSALLFGVTLALRALAKGLGRTPLAQQAKLTEDSKEASVSPEITKGVMQKTEE
FT                   QRESIQSEKTRTDSPGHTDSLSLFGIFETKTKTKRNQPDSPSIPHSKSESALNQLIPSQ
FT                   NSTILGLA"
     atgcctcatg cgagtgatga aaatcaggct tccaagccta ctgatttagt cttcatttta        60
     gcaattgctg gtcgtatcga cgcgcaaagt agaattctcg ctcaaaaact cgataaaagt       120
     cgcagtatct attatgccta cgctgttatg gattctctaa gctcctcgta cagcatgttc       180
     aaatattttt ttgatctgtt tgcatctcct aatgataacg atgcgatgca tgaattctta       240
     aattctccaa ccggtcttat taccattgca gttgagtcag tatttttagt taccttttct       300
     gttttggcct gtcaatttga gaacgaaaaa gaagattact ataaaaaatt tattgctaat       360
     gcctggccat attttcgtga tgtcatgaag ggcctgaaaa atgcttacaa aggctggaga       420
     agcgctgttg ttgcattcag tttaattgga ggagtggatg caaaatttct tattcttcca       480
     atgggagtga ttttgggggt atttgctgca gccaacaggt tttggatacg tagcatgctg       540
     gaagatcgta aaacaatgat gagtgagaat atagcgcttc tcatggaaat aaaaaaatta       600
     atttctttat ctcatgagga aagcttttct tatttcaagc gaatcagatc ccagaccatg       660
     caaactcgta atttcgcatt ctgggctgtt gctgcaggcg gactacttga tggtttatat       720
     ctctacgttg gtgtattgag tctggctgta ttgtcaccgc agttgcttat ggcaatggcg       780
     cttatttgtg ccttttatac agtggcttgt gttattaccc gtatttatga ggaatatgat       840
     ttccagttga gattattagt gacgcaaacc aaatgtcaat tggctttaat taccaaagaa       900
     ctggaaacta attacgccaa attactctta ttgcaagaca aaatggatct ggacaaagct       960
     gatcaggaag agctcaaacg actaaaaagg ttagtccata atttgataac ccggtttgac      1020
     gatagtcgta agttattatc ccaacaatcg aaccgcactt atttatcatc tgctttgttg      1080
     ggtatgaaaa atggattata tgcttatggc gcgcttgcaa gtgttttgtt tttagtgggt      1140
     tctattttag taatggcagg tgtttctttt cctcctgcct tgcttacagc ttgtattatt      1200
     ttaggtctgg tattagtgct cagtttcact attcattctt tggtgagtaa ttattggcat      1260
     cagaagaagc aggaaactca aaaacaacgt ccatatgagc gattgatcga gtggaataat      1320
     tgtcttaatg atgaatttaa caagactgag ctgttggctc ctgaagaatt taataaatta      1380
     ctaaatgatg gattgtcttt agacccttca ccacaatttt tctttcaaga atggtttgaa      1440
     gttttgcgtt ccttgttttc cggattcggt aaggggcaaa aatttattga ctttgcgggg      1500
     aattcgttac aggaactggg cgaggatggc cattatcgtg atacgcctgt tatgtacgtc      1560
     ttatctgtct tcagtgcctt attgtttggg gttactctgg ctttaagagc tctagccaaa      1620
     ggattggggc gaactccctt ggcgcagcag gccaagctga cggaggacag caaagaagcg      1680
     tcggttagcc ctgagataac gaaaggagtt atgcagaaaa ccgaagaaca aagggaatca      1740
     atccaatctg aaaaaactcg gactgattcc ccagggcata cggattctct gtctttattc      1800
     ggtatatttg aaaccaaaac caaaaccaaa agaaatcaac ccgactctcc atcaattcct      1860
     cattcgaaaa gcgagtcagc attaaatcaa ttaataccta gtcagaacag tacaattctg      1920
     ggtttagctt ag                                                          1932
//

If you have problems or comments...

PBIL Back to PBIL home page