(data stored in ACNUC7421 zone)

EMBL: CP000675.PE107

CP000675.PE107       Location/Qualifiers
FT   CDS_pept        complement(107419..107865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0108"
FT                   /product="conserved hypothetical protein; DUF188"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54107"
FT                   /db_xref="InterPro:IPR003791"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5I9Q7"
FT                   /protein_id="ABQ54107.1"
FT                   /translation="MTIWVDADACPKMIKDILFRAAIRTNTNLILVANSYLTYPNSPFI
FT                   RSVLVEKGYDRADHYITSHMKAKDLVITADIPLAAEVIVKQGLAMSPRGELFTANNIKQ
FT                   RLTLRDINEQLRSAGERTGGPSALSAKEKTNFANALDRWLVKSK"
     atgacgatct gggttgatgc cgatgcttgc ccgaaaatga taaaagatat cctctttcgc        60
     gctgccatac gaaccaatac caaccttatc ctggtagcta attcctacct tacttatcca       120
     aattcaccgt ttattcgctc agttcttgta gaaaaaggct atgaccgagc agatcattat       180
     attacgagtc atatgaaagc taaagatttg gtaatcacag cggatattcc tttggcagca       240
     gaagtaatag ttaagcaagg gttagcaatg agcccaagag gagaactgtt taccgcaaat       300
     aatatcaaac agcgtctgac tcttagagat atcaatgaac agttgcgttc agctggagag       360
     cgcacaggag gcccctctgc attaagcgcg aaagaaaaaa ccaattttgc caatgccctg       420
     gatcgttggc ttgtaaaaag caaataa                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page