(data stored in ACNUC7421 zone)

EMBL: CP000675.PE108

CP000675.PE108       Location/Qualifiers
FT   CDS_pept        107976..111950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0109"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54108"
FT                   /protein_id="ABQ54108.1"
FT                   /translation="MKQLISIIKGQIQQLPIPDLKHLLLSHLKEDAHDLTELFCQQTPA
FT                   QKNQFSHNQSVPFGLPASLSVLAIVLTYAPNLLHRELSEQLLTMLDSIRETETSVDNQL
FT                   AERCTEQLNYYSDAKPVLIALKERGAKDLIQILEQADERSLLAFSHLAKDTDLNVLIET
FT                   FLVKNNKDLDLVNRNHLVQFLRQPDLAGWLTRFLDSLIDGSINALSIRLLLSLISSVKA
FT                   IEKLKAARACLAQYPFSIDLHAMRAVFDFYQYELKRDLFSPESHLVMQLLHDLLKNTKL
FT                   DKQQEFFQGLSQETVLLIIEYCIAEYNKTTGEEKQNCKNLLTRLCSAFSDSSQDFLGKI
FT                   RTKINQLDPYLFDTPQLYQLASDLITKSCNSGKESLSSSPIALLLSMPQFVGVCTPKVL
FT                   KQLVERYSLYTLTLNQKDYKQDLCFKEYAPYFDEINEHMAQIERNLLIHPEAQSFWLDK
FT                   KYSLLQFRVEISKSALLHQMECLLEANKGGEELNNKGLEVLYHYYALSYPNLRSDLFLK
FT                   VVNHIYSRFFIKGNNETEARDGLFHWLKQNFPLIDKLPKDLDRKKEIFLYNSAGKKIGF
FT                   LGESNAAMTFVNEEIVLLAQTGSMDINEPLYDQEGLVLGYLTEESCLRSESAIHKNAAA
FT                   WVLAGLSKSDLESSSFGLESLLHNVLFENSIGVLYQCESICLDANKRIWLNNKLLKEIQ
FT                   EAPGEIPASVLYPLLDHFEDETVFELLGVIRNKNNALELFHYILNRDSRCSILLNGLYE
FT                   SDFQRFLEHQGADVCLADYLVNYYDKPWFSEVLLRFAYHGKKYKKPDLLSSALTFITKE
FT                   ISRDKKQETICDAVLDRLISSEACAALVLKEFLGDRTHNSIQRVNNPEIGKVSQFFDRR
FT                   HIVSLIAQLNKTSYWEQNAQYKLALHILANQHGRLFSETDLNPDSPQVWQGKELKELAC
FT                   FTSRHLSKKRPFDNKHDIGYRVLGELLFRCANSGITSLFYKQKTLNRAITRLSITEPFL
FT                   VRMVDKLWMPKGIRELYGKSLFFKGSWFDDQVFLQKELKDHHPLLDWSHFIKQTWNKRD
FT                   KQKKSPIICTYLLSYTGRKSVLSRLLQDYFNSFQGMPDYIRPVSQLLRFFPQRDVSAVI
FT                   YDALEAEMIKKPQLLDRQILSDMAFYYGKQLARKDTSFPQADINLLTYWGQNKHYSLVK
FT                   RGCELLVRDCEDKGVKKRLVSAAKEAEVEQDLSSSVQTFYFGLIKFFKRLWHYGFNAEN
FT                   SSSKIIKFCDDPTPGPTRKKAGDLINAPVAESRTNSLYLGFSERRKQLISLLATIKSSP
FT                   AHFTRVVNYSDNTQTFFGEQPKQSIDYNTPAIPSSFESIM"
     atgaagcagt taataagtat aataaaagga caaattcaac agctccccat tcccgacctg        60
     aagcatttgt tgttaagtca ccttaaagaa gatgctcacg atttaacaga actcttttgc       120
     caacaaaccc cggctcagaa aaatcaattc tcgcataatc aatcagtccc atttggttta       180
     ccggcttcgt tgtctgtact cgcaatcgtt ttgacgtatg cccccaatct gctacaccga       240
     gagttatcag agcagttgct gacaatgtta gattcaataa gagagaccga aaccagtgtt       300
     gataatcaat tagcagagag atgcacggag caattgaatt attatagtga tgcaaaacct       360
     gtccttatcg cgctgaaaga aagaggagcc aaggatttaa ttcagatctt ggagcaagcc       420
     gatgagcgca gtttgttagc cttttctcat ctggctaaag atactgattt aaatgtttta       480
     attgaaacct ttttagttaa aaacaataag gatttggatt tagtcaatag aaaccatttg       540
     gtacaatttt tacgtcaacc tgatttggca ggatggttaa cccgtttcct tgattcatta       600
     atcgatggat ctatcaatgc tctctcaatt cgattgttgt tgtctttgat ttcttctgtg       660
     aaagcgattg agaaactgaa ggcggctaga gcctgccttg ctcagtatcc tttttcaata       720
     gatttgcacg ccatgcgggc tgtgtttgac ttttatcagt atgaattaaa aagagattta       780
     ttttctcctg aaagccattt agtcatgcag ttgctgcatg atttattaaa aaacactaaa       840
     ttagacaaac aacaagagtt ttttcagggc ttaagtcagg aaactgtgct tttgatcatt       900
     gagtattgta tagcggaata taacaaaacg actggggaag agaagcagaa ctgtaaaaac       960
     ttgcttacca ggttatgttc ggctttttct gattccagcc aggacttttt ggggaaaata      1020
     agaacaaaaa ttaatcagct ggatccttat ctctttgata cccctcagct atatcagctg      1080
     gcatccgatt taataactaa atcatgtaac tcaggaaaag agtcgttatc cagttctcca      1140
     atcgctttat tgttatccat gccacaattt gtcggggttt gtacgcctaa ggttttaaaa      1200
     caattagttg aaagatacag cttgtatacc ttaactctga atcagaagga ctataagcaa      1260
     gacctttgtt ttaaagaata tgctccatat tttgatgaaa tcaatgaaca tatggctcag      1320
     attgagcgaa atctgcttat tcatccggaa gctcagtcat tttggctgga taaaaaatac      1380
     agcttattgc agtttagagt tgagatcagt aaaagtgctt tgcttcacca aatggagtgt      1440
     ttactggagg cgaacaaggg aggagaggag ctaaataata agggattaga ggtgttatat      1500
     cattattacg ccttgagtta tcccaattta cgttcggatt tattccttaa agtggtaaat      1560
     catatttatt cacggttttt tattaagggg aataatgaaa ccgaagctcg ggacgggtta      1620
     tttcactggt taaaacaaaa ttttcctcta attgataagt tgcccaaaga cttagacaga      1680
     aaaaaagaaa tttttttata taactctgcc gggaagaaga ttggatttct tggtgagtct      1740
     aatgctgcaa tgacttttgt taatgaggaa attgtattat tagctcaaac gggctctatg      1800
     gatatcaatg agcctttata tgatcaagag ggtttggttc tcgggtattt aacggaagag      1860
     agttgcctaa gaagcgaaag tgccattcac aaaaatgctg ctgcctgggt tttagctggt      1920
     ttgtccaaaa gtgatttgga aagttcctcg tttggattgg agtccctgtt acacaatgtg      1980
     ttattcgaga actcgatagg ggttttatat caatgtgaat ccatttgcct tgatgccaat      2040
     aagcgtatat ggctgaataa taaattatta aaagaaatcc aagaggcccc aggagaaatc      2100
     cctgcgtctg ttttatatcc attgcttgat cattttgagg atgaaacagt atttgaatta      2160
     ttaggcgtca tcaggaataa aaacaatgcg cttgagcttt ttcattatat tttaaaccga      2220
     gactcaaggt gttctatttt actgaatggc ttgtatgaat ctgattttca aagatttttg      2280
     gaacatcaag gcgccgatgt ttgtttagct gattatttgg ttaattacta tgataaaccc      2340
     tggttttcag aagtcttact acgatttgcc taccatggta aaaaatataa aaagccagat      2400
     cttctaagta gtgccttgac tttcattacc aaggaaattt ctcgagataa gaagcaagag      2460
     acaatctgtg atgctgtact ggatcgttta ataagttctg aagcatgtgc cgcattagtg      2520
     ttaaaggagt ttcttggtga tagaactcat aattccattc agagggtaaa taatccggaa      2580
     atcggcaaag taagccaatt ttttgatagg cggcatatag tgtcgcttat tgcacagtta      2640
     aacaagactt cttattggga gcaaaatgcg cagtataaat tggctttaca tattttggct      2700
     aatcaacatg gacgcctttt ttctgaaact gatttgaatc ccgattctcc tcaggtctgg      2760
     caaggtaaag aattaaaaga actggcttgt tttacaagca ggcatttatc caaaaaacgt      2820
     cctttcgata ataaacatga tattgggtat cgtgttttag gggagcttct tttcagatgc      2880
     gccaattcgg gaataacgtc attattttat aagcaaaaaa cgttgaatcg cgcaataacc      2940
     cgattgtcaa tcacagaacc ttttttagtc aggatggtgg ataaattatg gatgcctaaa      3000
     ggaatcaggg aactttatgg aaagtctttg ttttttaagg gttcctggtt tgatgatcaa      3060
     gtcttcttgc aaaaggaatt aaaagaccat catcctctgc tggactggag tcatttcatt      3120
     aagcaaacct ggaataaaag ggataaacag aagaagtccc ccataatatg tacttatttg      3180
     ttaagttata cgggtaggaa aagcgtattg tcgcgcttat tacaggatta ttttaattct      3240
     tttcaaggaa tgccagatta catcaggcca gtcagccaat tattgagatt tttccctcaa      3300
     cgcgatgtgt ccgcagtcat atacgatgcg ctggaagctg aaatgataaa aaaacctcag      3360
     ttattagaca ggcaaatttt aagtgacatg gccttttatt atggaaaaca gttggccagg      3420
     aaggacacaa gtttccccca ggctgatatt aatttattaa cgtattgggg gcagaataaa      3480
     cattattctt tagtaaaaag aggatgtgaa ctattagtca gggattgtga ggataaagga      3540
     gtaaaaaaac gattggttag tgctgccaaa gaagcggaag tagaacagga cttgagttcc      3600
     agtgtgcaaa cattttattt tgggctaatt aaatttttta aaagattatg gcattatggt      3660
     tttaatgctg aaaacagctc atcaaaaatt ataaagtttt gtgatgatcc tactcccggc      3720
     cctactcgta aaaaagcagg ggatctcatc aatgcaccgg ttgcagaaag caggaccaat      3780
     tctttgtatt taggcttttc tgaaagacgc aagcagttaa ttagtctttt agctactatt      3840
     aaaagtagtc cggcgcactt cacacgagtt gttaattatt cagacaatac tcaaacattc      3900
     tttggagaac aacccaaaca gtcaattgac tataatactc ctgcaatacc aagtagcttt      3960
     gaaagtataa tgtag                                                       3975
//

If you have problems or comments...

PBIL Back to PBIL home page