(data stored in ACNUC7421 zone)

EMBL: CP000675.PE109

CP000675.PE109       Location/Qualifiers
FT   CDS_pept        112168..112632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0110"
FT                   /product="hypothetical protein conserved within
FT                   Legionellae"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54109"
FT                   /protein_id="ABQ54109.1"
FT                   /translation="MRILLSFFLLLLSTGLFAESTFPDGCRAVPVQGQSVTLKAKKNKL
FT                   VFIHNVTNLDLWITHPVTDPGASAGWTSRLQAGKWSALVVDKPAFILNCIESRPGHEQQ
FT                   IPCENAIAVCQWKGVKIPASNQGTFWVAEDLSLAALNAAVGGRGFVLPEK"
     atgagaattt tgctctcgtt ctttctttta ttgctttcaa cagggctttt tgcagaatct        60
     acttttcctg atggttgtcg ggctgttcct gtacaaggtc aatcagtgac tttaaaagcc       120
     aagaaaaata agttggtgtt tattcacaat gtgaccaact tggatctatg gattactcat       180
     ccagttaccg atcctggggc cagcgctggt tggacaagcc gattgcaagc tggtaaatgg       240
     tcagctttag tagtggacaa acctgccttt attttaaatt gcatagaatc aaggccagga       300
     catgagcaac agataccttg tgaaaacgct attgccgtat gtcaatggaa aggagtaaaa       360
     ataccggcaa gcaatcaagg tactttctgg gtagcggaag acctgtcatt agcagcatta       420
     aatgccgcag tcggtggaag aggctttgta ttgccggaga aataa                       465
//

If you have problems or comments...

PBIL Back to PBIL home page