(data stored in ACNUC7421 zone)

EMBL: CP000675.PE114

CP000675.PE114       Location/Qualifiers
FT   CDS_pept        118420..119613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0115"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54114"
FT                   /protein_id="ABQ54114.1"
FT                   /translation="MPKVIIFTDFDGTVTGRSGNETVFTDFYQSLLQGYKKDVEQDYKN
FT                   TPMKDPIEAQALFEAKYGKYNENFDHDQQDVDFLMSPEAVAFFHEVLKNDDVTVNIVTK
FT                   NRAEYIKAVFKYQGFSDEEIEKLTILESGYKFNDVNSRLNHPTERANRVYILDDSPTDY
FT                   AEMLRAVKGKGYNEEEIRGHRKNPGEFEWSQYLEDVREMFPPKENSPEEVRLPYEQGDE
FT                   VSIGEEIPVLLQEDNLSRREETATVLSNQPVPSSDFRTLKIMGAFAGIGFGFGFALGVT
FT                   LVATGVFAPPGVGLLGALTLGAISGTGAAALSSAIGFAVAKGTEITPEPVSEEPVPAVK
FT                   QSSHEAMRGLGGSQLLSTNNIHPVGHFPSVLSGRTPTKGKEEQCQKEYVLTNPLNNS"
     atgcctaaag taattatttt taccgatttt gatggcactg taaccggaag aagcggtaat        60
     gaaactgtat ttaccgactt ttatcaatca ctgttacaag gctataaaaa ggatgtagag       120
     caggattaca aaaacactcc aatgaaagat ccaattgaag cccaggcttt attcgaagca       180
     aaatatggaa aatacaacga aaattttgat catgaccagc aggatgttga ttttctgatg       240
     agtcctgaag cagtagcgtt tttccatgaa gtactaaaaa atgatgatgt gaccgtcaat       300
     attgtcacca aaaaccgagc ggaatacatt aaagcagttt ttaaatatca aggattttcc       360
     gatgaagaaa tcgagaaatt aaccattctg gagtcgggat ataaatttaa tgatgtcaat       420
     tcccggctta atcacccaac agaaagggcc aaccgggttt atatccttga tgatagcccg       480
     acagactatg ctgagatgct gcgtgcagta aaaggtaaag gatacaatga ggaagaaatt       540
     cgtgggcatc gtaaaaatcc tggtgagttt gaatggtccc aatatttaga agatgttagg       600
     gaaatgtttc cgcctaaaga gaactctcct gaagaggttc gattaccata tgagcaaggg       660
     gatgaggttt ctatcggtga agagatccct gttttacttc aagaggataa tttatcccgg       720
     cgtgaggaaa cggctactgt cttatctaat caaccggttc cgtcttctga ttttcgtacc       780
     ctaaagatta tgggtgcttt tgcaggcatt ggctttggtt tcggctttgc tttaggtgtt       840
     acattggttg ctaccggagt ttttgctcct ccaggtgttg gtcttttagg agctttgact       900
     ttaggtgcta taagtggtac tggcgctgct gcactatcaa gtgctattgg atttgcagtt       960
     gctaaaggaa cagaaattac accagagccc gtaagcgaag agcctgttcc tgctgttaag      1020
     caaagcagcc atgaggctat gcggggtttg ggtggctctc aactactgag cacaaacaat      1080
     attcatccgg ttggtcattt cccaagtgtt ctatcaggaa gaactcccac gaaaggtaaa      1140
     gaagagcaat gccaaaaaga atacgtattg actaatccac tcaataattc atag            1194
//

If you have problems or comments...

PBIL Back to PBIL home page