(data stored in ACNUC7421 zone)

EMBL: CP000675.PE122

CP000675.PE122       Location/Qualifiers
FT   CDS_pept        complement(127823..128413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0123"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54122"
FT                   /protein_id="ABQ54122.1"
FT                   /translation="MLRILLYFLLLINTTFCLAKTEKAIFAGGCFWCMEADFDHLPGVL
FT                   STTSGFDGDTLKNPTYEQVSAGNTHYAESVMVEFDPNKLSYKKLVEYFFMHIDPTVKNA
FT                   QFCDQGRQYRSAIFYMNDQQKKIAMEYKKELEQKFPTIYTEIVPSTSFYPAEEYHQNYY
FT                   KKNPIRYKYYRYRCGRDARVQEVWGNKKQENNS"
     atgttgcgta tccttttgta ttttctctta ctcattaaca caacattttg tctggcaaag        60
     actgaaaaag ccatttttgc aggtggatgt ttttggtgca tggaagcaga ctttgaccat       120
     cttcctggag tcctgtcaac cacatcagga tttgatgggg acactcttaa aaatccaact       180
     tatgaacaag tttctgccgg taatacccat tacgccgaat cggtaatggt agagtttgat       240
     cccaataaat taagttacaa aaaactggtt gagtatttct ttatgcatat tgatcctacc       300
     gtcaaaaatg cgcaattttg tgatcagggc cgccaatatc gcagtgcaat tttttacatg       360
     aatgatcaac aaaagaaaat tgccatggaa tacaaaaaag agttagagca aaaattcccc       420
     acaatttata cagaaattgt cccatcaact tctttttatc cggcagaaga atatcatcaa       480
     aattattaca aaaaaaatcc tatacgttat aagtattatc gatatcgttg tggccgggat       540
     gcccgagttc aagaggtttg gggtaataaa aaacaagaga ataattctta a                591
//

If you have problems or comments...

PBIL Back to PBIL home page