(data stored in ACNUC7421 zone)

EMBL: CP000675.PE123

CP000675.PE123       Location/Qualifiers
FT   CDS_pept        complement(128521..129117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0124"
FT                   /product="cytochrome oxidase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54123"
FT                   /protein_id="ABQ54123.1"
FT                   /translation="MLEQSLRHYYQLVLVDPILPALRDRITPLSITWLSGIFGLLFIPF
FT                   ILLDKPYIAISFLLLSGYLDTLDGSLARFQNRASDFGSAMDIVMDRIVEFSAVLALYLF
FT                   DPQHRATLAILMLGSILLCITSFLVVGIFSNNTTQKSFYYSPGIMERAEAFLFFIFMTL
FT                   FSSHFNFLAALFCFLVCLTALIRLFEFKKSVQAPG"
     atgcttgaac aatcattacg acattattat cagcttgtct tggtagatcc catactacct        60
     gctttacgtg acaggataac gccattgtcc attacctggt tgtcgggaat atttggcttg       120
     ttatttattc cttttatctt attagacaaa ccttatattg caattagctt tctcttgctt       180
     tctggatatc tggatactct tgatggttcg ctggcccgct ttcaaaacag agcctctgat       240
     tttggctcag caatggatat cgtcatggat agaattgtag aattttctgc tgttcttgct       300
     ttgtatcttt ttgatccaca acaccgtgcc actttagcca ttttaatgtt aggcagtatt       360
     ttgctctgta ttacaagctt tctggttgtg ggaatttttt ccaacaatac tactcaaaaa       420
     agtttttatt acagcccggg gataatggag cgtgccgaag catttctatt ctttattttt       480
     atgacattat tttccagcca ctttaatttt cttgccgctc tcttttgttt tttagtctgt       540
     ttaaccgcgt tgataaggct ttttgaattt aaaaaaagcg tacaggctcc aggttag          597
//

If you have problems or comments...

PBIL Back to PBIL home page