(data stored in ACNUC7421 zone)

EMBL: CP000675.PE125

CP000675.PE125       Location/Qualifiers
FT   CDS_pept        complement(130739..131545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0126"
FT                   /product="conserved hypothetical protein; DUF155"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54125"
FT                   /protein_id="ABQ54125.1"
FT                   /translation="MECLSFCVAKTIDLTRLDLHLKNVSKEFSAVKTRDVIRLNSHRNK
FT                   DHTVFIFKNGTVVSWGVKRYQIHEYLDIIKLLVDKPVALLVHDEFHYQIGDKTAIEPHG
FT                   FYDVDCLTIEEDSDELKLSLSYGFSQSVKLQYFETIIDALIEKYNPLIQALSHKGEMPI
FT                   SRKQIQQVIGEILGAKSELNLISNFLYHPKYFWQHPTLEEHFSMLERYLHIQRRVNAIN
FT                   HRLDTLNEIFDMFNGYLENRHSHHLEIIIIVLITVEIIIAVMNFHF"
     atggaatgct taagtttctg tgtggccaaa accatagact tgactcgtct tgatctgcat        60
     ctaaaaaacg tctctaagga atttagtgct gtaaaaaccc gagatgtaat aagattaaat       120
     tctcatagaa acaaagatca taccgtgttc atttttaaaa atggaactgt cgtatcttgg       180
     ggtgtaaaaa gataccaaat ccacgaatac ctggatatta ttaaactgct tgtagacaaa       240
     cctgtagcac ttttggtgca cgatgaattt cattatcaaa ttggtgataa aacagccata       300
     gaaccgcatg gtttttatga tgtagattgc ctgaccattg aagaagacag tgatgaacta       360
     aaactcagtt tgtcttacgg cttttctcaa tctgtaaaat tacagtattt cgaaaccatt       420
     attgacgcat tgattgaaaa atataatccg ctgattcagg ccttatctca taaaggagaa       480
     atgcctataa gcagaaaaca aattcaacaa gttattggtg aaattttagg tgccaaaagt       540
     gagctgaatt tgatcagtaa tttcttatac caccccaaat atttttggca acaccccact       600
     ttagaagagc atttttccat gcttgaacgt tatttacata tacaaagacg tgtcaatgcc       660
     attaaccatc gtcttgatac gcttaatgaa attttcgaca tgttcaatgg ttatttggaa       720
     aatcgccata gccatcactt ggaaataatt attattgtat taattacagt agaaattata       780
     attgcggtta tgaatttcca tttttag                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page