(data stored in ACNUC7421 zone)

EMBL: CP000675.PE126

CP000675.PE126       Location/Qualifiers
FT   CDS_pept        complement(131644..131913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0127"
FT                   /product="hypothetical protein conserved within
FT                   Legionellae"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54126"
FT                   /protein_id="ABQ54126.1"
FT                   /translation="MNSKVFSQRFNRELATLGFPEDLTEKTKAVSKVFGVTRHLANAMI
FT                   FGHVLPDKEQLDKIAEILEVCPQWLSGATDRKKAYSGRETADSV"
     atgaatagta aagtattttc gcaacgtttt aatcgtgaat tggcaactct gggattcccc        60
     gaggatttaa cagaaaaaac gaaagccgta tcaaaagtat ttggcgtcac acgccatttg       120
     gctaatgcaa tgatatttgg ccacgttctt cctgataaag aacaactgga taaaatcgca       180
     gaaattctgg aggtttgtcc tcaatggcta agtggggcaa cggataggaa aaaagcctac       240
     tcaggccgtg agacggctga tagtgtgtaa                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page