(data stored in ACNUC7421 zone)

EMBL: CP000675.PE127

CP000675.PE127       Location/Qualifiers
FT   CDS_pept        132521..134323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0128"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54127"
FT                   /protein_id="ABQ54127.1"
FT                   /translation="MIQLGDLLKPTWAAEQSLNNAWSVLNDEEKETIKSRMEKIFYNEI
FT                   PFQLEHDKLIYIHLFSLFAQLETIGLRGLIKSLEKLRGTDLYQQMRQQITDEIFHATVF
FT                   AKVAFQLSAPYALPLGHQKSIKHFISSLEGEEDLATSITLVNLVGEGWVEELCIAMKEK
FT                   NIAVTIFETVLEDESRHMDEYDLYRQIGLPNKDYLRKKLAIFEDELINTVFAHEQYLTT
FT                   LGILLGKEGALKLLNNINNKHHWMLKKIGLTPSAHWQLFMDTMPLLMKNLSHDFEKDKA
FT                   IEPTNIRKLLSAIWNDPELPTESAIFNINVTPVCFFEKKFKPETITCLMLQALSKACFD
FT                   NPQTRNYIFNHKLYHSHNSYVALAVKIPGSDQLGAIELKNCHEMTMTELAQHIQHDMRI
FT                   MKYCYEKTQSLQKEHPYLIEVVNRLLTPRHERVYRDFLFARPAISLSNIGHWGYQAAVS
FT                   PLFPNETFKITLTEIERKQVWNKINNTFEVQDVLPVGMSVDHRVFDGNIPFPRYMQEAF
FT                   DQMFQDMEQSRIKPLSKPFSNLDNFIKYSNTLLENDLEFGFLYLFSLMHVWKNYISYDE
FT                   LSKTVEENYERIKQALSKSEHQLG"
     atgattcagt taggcgattt gttaaaacca acttgggctg cggagcagtc tttaaataat        60
     gcttggtctg tattgaatga cgaggaaaag gaaaccatca aaagccgaat ggagaagata       120
     ttttacaacg aaattccttt tcaacttgag catgacaagc ttatctatat tcatttattt       180
     tccttgtttg ctcaattaga aacaattggc ctaagagggc ttataaaatc tctagagaaa       240
     ctccgtggaa cagatttgta tcaacaaatg cgtcaacaaa ttaccgacga gattttccat       300
     gccactgttt ttgcaaaagt tgcgtttcag ttgtccgctc cttacgcatt accacttggc       360
     catcaaaaga gtatcaaaca ttttatttct tctcttgaag gtgaagagga tctggccact       420
     tctatcactt tggtcaattt ggttggagaa ggatgggtag aagaattatg cattgcaatg       480
     aaagagaaaa acattgcagt aactattttt gaaacagtcc ttgaagatga aagccggcat       540
     atggacgagt acgatttata tcgtcagatt gggttgccaa ataaagacta tttaaggaaa       600
     aaattagcaa tttttgaaga tgagctgata aataccgtat ttgcgcatga gcaatatttg       660
     actacccttg gtattctatt aggcaaagag ggggcactga aactgctcaa taatatcaat       720
     aataaacacc attggatgct taaaaaaatt ggcttaactc cttcagccca ttggcaattg       780
     tttatggata ctatgccttt attgatgaag aatttatcgc atgattttga aaaagacaaa       840
     gccattgaac cgaccaatat tcgtaaatta ctttcagcga tttggaatga ccccgaatta       900
     ccaactgagt ctgctatttt taatataaat gttactcctg tttgtttttt tgaaaagaaa       960
     tttaaaccgg aaacaataac ttgcctcatg ttacaagcat tgagtaaagc ttgttttgat      1020
     aatccgcaga cgagaaatta tattttcaat cataaactgt accactcgca caatagttac      1080
     gtagcgcttg cggtaaagat tccaggtagt gatcaattag gtgcgattga gttaaaaaat      1140
     tgccatgaga tgactatgac tgaattagct caacacattc agcatgacat gcgtattatg      1200
     aagtactgtt atgaaaaaac acaatcctta caaaaagagc atccctattt aatcgaggta      1260
     gtcaatcgct tacttactcc acggcatgag cgagtgtacc gtgatttctt atttgccaga      1320
     cctgctattt ctttgagcaa tattggtcat tggggatatc aagcagcggt ttcaccctta      1380
     tttccaaatg aaacgtttaa aataactctg acagaaatcg aaagaaaaca agtctggaat      1440
     aaaataaata acacatttga ggtgcaagat gttttgcctg taggcatgag tgttgatcac      1500
     cgagtttttg atggcaatat cccgttcccg cgttatatgc aggaggcttt tgatcaaatg      1560
     tttcaagaca tggagcaatc caggataaag ccactgtcaa aacccttttc aaatttagat      1620
     aactttatca agtacagtaa taccttattg gaaaacgacc tggagtttgg atttctgtat      1680
     ttattttctt taatgcatgt atggaaaaat tatatttcat atgatgagct atcaaaaaca      1740
     gtggaagaaa attacgagag aataaaacag gcattatcaa aaagcgaaca tcaacttggc      1800
     tga                                                                    1803
//

If you have problems or comments...

PBIL Back to PBIL home page