(data stored in ACNUC7421 zone)

EMBL: CP000675.PE134

CP000675.PE134       Location/Qualifiers
FT   CDS_pept        complement(142016..142324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0135"
FT                   /product="conserved hypothetical protein"
FT                   /note="YCII domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54134"
FT                   /protein_id="ABQ54134.1"
FT                   /translation="MFIVQLTYLVPINEVNKYLQAHREFLDYHYKQGLLVASGPMKPPT
FT                   GGIIIAATNDRAHLESVFKQDPYYLAEIAEYQFIEFTPVKHRNELKELIQKTEGKLC"
     atgtttattg ttcaattaac ctatttagtt cccatcaatg aagtaaacaa atatctgcag        60
     gcacacaggg agtttctaga ttaccactac aaacaagggc tattggttgc ttctggcccc       120
     atgaaacctc caaccggcgg gattattata gcagcgacaa atgacagggc ccatttagag       180
     tcagttttta aacaagaccc ttattattta gcagaaattg ctgagtatca atttatcgag       240
     tttactccag taaaacacag gaatgaactc aaggaactta ttcaaaaaac ggaaggcaaa       300
     ttatgttga                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page