(data stored in ACNUC7421 zone)

EMBL: CP000675.PE138

CP000675.PE138       Location/Qualifiers
FT   CDS_pept        145326..145793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0139"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54138"
FT                   /protein_id="ABQ54138.1"
FT                   /translation="MVWPIIWRWILDLGWLCFLLILFWYFWKKRRDLVEARSWLKAKGH
FT                   VTRCEWTRVGHSVWPRIEYIYEVYEKDLTGEYLFLDTTFNTPNSKYSRSIAYKVAIAYR
FT                   DNSEIDVYYNPNRPEQSALDVTIPKKLTFILILISSLILLHIGIIVWRLLV"
     atggtgtggc cgataatttg gagatggatc cttgatttag gatggctgtg ttttctttta        60
     attctttttt ggtatttttg gaaaaaaaga agagatttgg ttgaagcaag atcctggtta       120
     aaagcgaagg ggcatgtcac gcgctgtgag tggacaagag tagggcatag tgtttggcct       180
     agaatagaat atatctatga agtttatgag aaggatttga caggggaata tttgtttttg       240
     gatacaacat ttaatacacc caatagtaaa tattcccgaa gtattgcata taaagtggca       300
     atagcttaca gagataactc agaaattgac gtctactata atcccaaccg tcctgaacaa       360
     tctgctttag atgttaccat acctaaaaaa ctaactttta ttttaattct aatcagctca       420
     ttaattttgc tgcatattgg tattattgtt tggcgtctcc ttgtttag                    468
//

If you have problems or comments...

PBIL Back to PBIL home page