(data stored in ACNUC7421 zone)

EMBL: CP000675.PE139

CP000675.PE139       Location/Qualifiers
FT   CDS_pept        complement(145768..146298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0140"
FT                   /product="IcmL-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54139"
FT                   /protein_id="ABQ54139.1"
FT                   /translation="MNKTITIALSLLLSIASKLTYAGPDRAQLAVWANEAIIATYTFDY
FT                   KNYMQQQKEIAKYFSADGWIAYSKALNQSKLPEVVQKNAYFVNAVATEPPKLITLDPTH
FT                   WQAIMPILVVYKNPQYEQKQNLKVILGFTVASPGQGVRGFSITSLQSTPTSPPCQCKFE
FT                   ETPENTKQGDAKQ"
     atgaacaaaa caatcactat tgccttgagt ttacttctaa gtattgcctc aaaactaact        60
     tatgcagggc cagatagagc acaattggca gtttgggcta atgaagcgat tattgccact       120
     tacacttttg attataaaaa ttacatgcaa caacaaaagg aaatagccaa atatttttca       180
     gctgatggct ggatagccta tagcaaagcg cttaatcaat caaaactgcc tgaagtagta       240
     caaaaaaatg cctatttcgt caatgctgtt gccacagaac cacccaagct gatcaccctg       300
     gatccgacac actggcaagc tatcatgccc atactggtcg tatataaaaa cccccaatac       360
     gagcaaaaac aaaatttaaa agttatatta gggtttaccg ttgcatctcc cggacaaggt       420
     gtaagaggtt tcagcataac cagcctgcaa tccaccccca ccagcccgcc atgccaatgt       480
     aaatttgaag agacgcctga gaatactaaa caaggagacg ccaaacaata a                531
//

If you have problems or comments...

PBIL Back to PBIL home page