(data stored in ACNUC7421 zone)

EMBL: CP000675.PE14

CP000675.PE14        Location/Qualifiers
FT   CDS_pept        17050..17889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0014"
FT                   /product="pirin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54014"
FT                   /protein_id="ABQ54014.1"
FT                   /translation="MKAIEVERLIQGTLIREGGGVKLRRYIGADKTNHFEPILLFDYFD
FT                   SSDPLDYLAGFPPHPHRGFETITYLMEGSITHEDNKGNKGVINAGGVQWMTAGKGIIHS
FT                   EMPSSSTGRLHGLQLWLNLPAAEKWREPRYQEKSSDQLPIEVMESGATIKVIAGRIDQG
FT                   LSSPIVEIATRPLFLDINLPANATIQQTIPDDYQAVLFVIEGAVNTGGQQITAGTLASL
FT                   TNGERIQIEGKDKENRNHCLLIAAAKLHEPIVRYGPFVMNTQEEITQAIHDFRTGHF"
     atgaaagcaa tagaagtaga gcggttaatc cagggaacat taatacgaga aggtggagga        60
     gttaaattac gtcgctatat aggagctgat aaaaccaatc actttgaacc tatactgctt       120
     tttgactatt ttgacagttc agatccattg gattatctcg ccgggtttcc gcctcatccg       180
     catcgcggat ttgaaacaat tacctatctg atggagggaa gcattaccca tgaagacaat       240
     aaaggtaaca aaggagtaat aaacgcaggt ggtgtgcagt ggatgactgc aggaaaaggg       300
     attattcatt cggaaatgcc ttcgtcttca acgggccggt tgcatggttt gcagttgtgg       360
     ttaaatttgc ctgctgcaga aaaatggcga gaacctcgtt atcaggaaaa atcatcggat       420
     caactaccta ttgaagtcat ggaatcaggt gcaaccatca aagtaatagc aggaagaatt       480
     gatcaaggat tgagttcacc cattgttgaa attgcgaccc gacctttgtt tctagacatc       540
     aatctccctg ccaatgcaac tattcaacaa acgattcctg acgattatca agctgtcctt       600
     tttgtcattg aaggtgctgt gaatacagga ggacagcaaa ttaccgcagg cactttagcc       660
     agcctgacaa acggtgaaag aatacaaata gaaggcaaag acaaagaaaa tagaaatcat       720
     tgtttactga tagctgcggc taaacttcat gaacctattg ttcgctatgg tccttttgta       780
     atgaatactc aagaagaaat tacgcaggca atacatgatt ttcgtacagg acatttttag       840
//

If you have problems or comments...

PBIL Back to PBIL home page