(data stored in ACNUC7421 zone)

EMBL: CP000675.PE149

CP000675.PE149       Location/Qualifiers
FT   CDS_pept        complement(159841..160017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54149"
FT                   /protein_id="ABQ54149.1"
FT                   /translation="MKSIEDFTGFSESGIDDAIQNALKKAGNPTHFEVVETLGSQDSQS
FT                   DRRYRVTLKTLSD"
     atgaaaagta tagaggattt tacaggtttt tcagaatccg ggattgatga tgccattcaa        60
     aatgctttaa aaaaagcagg taatcccact cattttgaag tcgttgaaac actaggttca       120
     caagatagcc aatcagatcg acgatatcgg gtaacgctta aaacactgag tgattaa          177
//

If you have problems or comments...

PBIL Back to PBIL home page