(data stored in ACNUC7421 zone)

EMBL: CP000675.PE150

CP000675.PE150       Location/Qualifiers
FT   CDS_pept        160195..162663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54150"
FT                   /protein_id="ABQ54150.1"
FT                   /translation="MGKGIILRVLENTILSPQVFDTLERLLPGYKVEYFKEQPDYRKSI
FT                   ARRIDSLHDAFSFILKAYPLDPKHTSLTVATLSTYAAECKASCDLEKLTLEELHLELER
FT                   FTAKLVEAIAIAWKWPKGKAVKEAIASLNEAEQYVLMSRGRSDIATIMPIEMGSETKYV
FT                   LQYDESLSPVYEQWLTELKQLKEYNFPKTPAWFKNLPPYQQAYYCNLNLSSVDPKKALQ
FT                   HFNTFFGNWGDIAKRSLNLTTELNQIHTNSPPYPSWFNELSPAQQAMIRVLSATPHEIK
FT                   SSLKEFKKFMVEQARNDQYASTLSLVPKLPQWYWVLSEQQQYFLEYALKNAEKVEDVVS
FT                   YLSSRHRTLPAPANYGAHSLYLIDGEGKETLFYDKRYRSSHVASRDSLKFPEDVQQRHV
FT                   DSNLVKVMEFAKPQQPLLLQTLISPIHAVDYIPTVVTDFLPELPPDLELYKIAREAVTR
FT                   SKRRHEIFQHNHPFNIAKRYYYTQATDTDSEFLLKAAQKYVSSKLGLQALIDDYKAVLE
FT                   SPLGSATFWDYDGRELFLSSLEELIILNMGGYSYGSCVSGKDRKAVELLHTDAMILYKA
FT                   KYGNWPKFGIPKEKQERVNFINIVVDLYISRHQHELAGQNAPGSEGIKTPDWYWPNDIA
FT                   EAINERLGTEKALAYDDRLATDNEVKNISKDLRSFFLPENELHCLLIAKQLGEKMCTML
FT                   YDVLSALINEERRFQKSSKDSWKLRWFSDKDVSSTPTGILNIREVMHDENSGNDNVLRI
FT                   GKIFAAVLNRPESDSSRTTATNSVYDRIRKLLQPLSSESTLQTLAEEAILEWSSLFESS
FT                   KRENSGLVYM"
     atgggaaaag gtataatttt acgtgttttg gaaaatacaa tattatctcc tcaggtattt        60
     gatacactag agcgacttct acctggttac aaagtagagt atttcaaaga gcagccagat       120
     tatcgtaaaa gcatcgctcg ccggatagac agccttcatg atgccttttc atttatctta       180
     aaagcttacc ccctcgatcc aaaacatact tctctgacgg ttgcaacctt aagtacttat       240
     gccgcagaat gcaaggcttc atgtgacctg gaaaaactga cattagaaga gttgcatctt       300
     gagctcgaac gatttacggc caaattggtt gaggctattg ccatcgcgtg gaaatggcct       360
     aaaggtaagg cagtcaaaga ggcgatagcc agccttaatg aagcagagca gtatgtctta       420
     atgagccggg gtcgtagcga tatcgctacc ataatgccta ttgaaatggg cagtgagaca       480
     aagtatgttt tgcaatatga tgaatccctg tctcccgttt atgaacaatg gttaactgaa       540
     ttaaaacaat taaaagaata taattttcct aaaacacctg cctggtttaa aaatctgccg       600
     ccctatcaac aagcttatta ttgtaatctg aatttaagtt ctgttgatcc taaaaaagcg       660
     ctgcagcact ttaatacatt ttttggcaat tggggagaca ttgcaaaaag gtcactgaat       720
     ttgaccacgg aattaaatca aatacatacc aactcaccgc cttatccttc ctggttcaat       780
     gaattaagcc ctgctcagca agccatgatt cgcgtcttgt ctgctactcc acatgagatt       840
     aaatccagct taaaagagtt taaaaaattt atggtggagc aagccaggaa tgatcaatac       900
     gcatcgactt tgagcctagt gcccaagctt ccacagtggt attgggtttt atccgagcaa       960
     caacaatact ttttggaata tgctctcaaa aatgcagaaa aggttgagga tgtcgtatca      1020
     tatttatcaa gccggcaccg aactttgcct gctccagcca attatggtgc gcacagttta      1080
     tatttaatcg atggtgaggg taaagaaact ttattttatg acaagaggta tcgctcaagc      1140
     catgttgcca gtcgtgattc gttaaaattt cctgaggatg tccagcagcg tcatgttgac      1200
     tccaacctgg ttaaggtgat ggaatttgcc aaacctcagc agcctttgtt attgcaaaca      1260
     ttaattagcc ctatccatgc agtagattat attccaacgg tggttacaga ctttttaccg      1320
     gaattacctc cggatctgga gttgtataaa attgcccgag aagcggtcac ccggagcaaa      1380
     cgcaggcatg aaatattcca gcataatcat ccttttaata ttgccaagcg ttattattat      1440
     actcaggcaa cggatacaga cagcgagttt ttattaaaag cagcgcagaa atatgtgtct      1500
     tccaagcttg gattgcaggc gctaatcgat gattataagg ccgttttaga gtcgccttta      1560
     ggctctgcaa cattttggga ttacgatggc agggaattat ttcttagctc tttggaagaa      1620
     ctgattattc tcaacatggg cggctatagc tatggctcct gtgtcagtgg taaagacaga      1680
     aaagcagtag agttattgca tactgatgcg atgattttgt ataaagcaaa atatggaaat      1740
     tggcctaaat ttggaattcc caaagaaaaa caagaacgag tcaatttcat caatattgtt      1800
     gtagatcttt atatctccag acatcaacat gagcttgcag ggcaaaatgc gccaggttca      1860
     gagggaatca aaacgcctga ttggtactgg ccaaacgata tcgctgaggc cattaacgag      1920
     cgcttgggca ctgagaaagc attagcctat gatgaccgat tagcaactga taatgaagtg      1980
     aagaatatta gcaaggattt gcgttccttt tttctaccag aaaacgaatt gcattgcttg      2040
     ttaattgcca aacagctggg cgaaaaaatg tgtacaatgc tttatgatgt gctaagcgct      2100
     ttaatcaatg aggagcgcag atttcaaaaa tcaagcaaag actcttggaa attacgttgg      2160
     ttctctgata aagatgtgag ctcaacacct actggaatac tcaatattcg tgaagtaatg      2220
     catgatgaaa actcgggcaa tgataatgtt cttcgtattg gaaaaatatt tgctgccgtt      2280
     ttaaatcggc cagaaagcga ttcatcaaga actacagcaa ccaattcagt ctatgatcgt      2340
     attaggaaat tattacaacc cctgtcatca gaaagcacat tacaaacatt ggcagaagaa      2400
     gcaattttag aatggtcttc tttgtttgag agttccaaaa gagaaaacag cggattggtt      2460
     tatatgtaa                                                              2469
//

If you have problems or comments...

PBIL Back to PBIL home page