(data stored in ACNUC7421 zone)

EMBL: CP000675.PE154

CP000675.PE154       Location/Qualifiers
FT   CDS_pept        164913..165983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0155"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54154"
FT                   /protein_id="ABQ54154.1"
FT                   /translation="MRIATLFSAVLFISPLWAAPKFFPSQPALNGVYDIKGTELCSTAK
FT                   HTLAYLNKGKNYDPQVIHDGKVIKISLDRVKKTLEFICQNQKKLNNPDFVKQHFDFIRW
FT                   YPDLRQAKQLSANKPLLQNIPKDKILMTKYFVHLAGASPKPSSAKPYPLYALPEDEQNL
FT                   TLDEANAKPGLIRFKYGKQAILSGALKNQPVSELAYLSRDDLEAALLQGTVVADFGPTA
FT                   GKKIFNVHRSNNITYDRTKTPYQQERFWYFKEVDGIKGYGKDAEYKITVNPKVTFAADL
FT                   AEFGLGKLLMIQYQDKSGRPMTKMGILADTGGAFNNNLYQIDYLAGSFAGKDALYRATR
FT                   DLPDYVDAYFMILKQP"
     atgcgaatag cgacattatt ttcagcagta ctgtttattt ctccactatg ggctgcgcca        60
     aaattctttc catcccaacc tgccttgaat ggagtatatg acattaaggg aactgaatta       120
     tgcagtacag caaagcatac tttagcctac ttaaataaag gcaaaaatta tgatccccaa       180
     gtgattcacg atggaaaagt cattaagatt tctttagaca gagtgaaaaa aaccttggaa       240
     tttatttgtc aaaaccaaaa aaaattaaat aacccggatt ttgtaaaaca gcacttcgat       300
     tttattcgat ggtatcctga cttaaggcaa gcgaaacaat tatctgccaa taaaccatta       360
     ttacaaaata tacccaaaga taagatattg atgactaaat attttgtgca tttggcaggt       420
     gccagtccca aaccaagctc cgcgaaaccc tatcctttgt atgctttgcc tgaagacgag       480
     cagaatttga ctctggatga agcaaatgcc aaaccaggac tgatccgttt caaatatggt       540
     aagcaagcga tattatccgg tgctcttaaa aatcaaccgg ttagcgaatt ggcttattta       600
     agtcgagatg atttggaggc ggctttactg caaggtactg ttgtcgcgga ttttggaccg       660
     actgcgggta agaaaatatt taatgtccat cgtagtaata atattactta tgatcgaact       720
     aaaaccccct atcagcagga gcgattttgg tatttcaagg aagttgatgg aattaaaggt       780
     tatggtaagg acgctgaata caaaattaca gttaacccca aggtgacctt tgcggctgat       840
     ttggctgagt ttggtttagg gaaattactg atgattcagt atcaagacaa atcaggacgc       900
     ccaatgacta aaatgggcat cctggctgat actgggggcg cttttaataa taatttatat       960
     caaattgatt atttggcagg aagctttgca ggaaaggacg ctttgtacag ggctactcga      1020
     gatttacctg attatgttga tgcttacttt atgattttaa agcaacctta g               1071
//

If you have problems or comments...

PBIL Back to PBIL home page