(data stored in ACNUC7421 zone)

EMBL: CP000675.PE16

CP000675.PE16        Location/Qualifiers
FT   CDS_pept        19639..20712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0016"
FT                   /product="multidrug resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54016"
FT                   /protein_id="ABQ54016.1"
FT                   /translation="MKEKFATWYKIATKHIRFFFSYSIPMFFKKAKNYINLPIIVVGLA
FT                   LIIGLFHLFSYLIPFTDNAFVVTNVTPVAADVSGFITEIYVKNGQKVKKNDPIFSVYRV
FT                   PYELAYQQAMADYKEGLKKIDVFQKQIERTVALIKATDSELEKAQFALGLKKNKNVAEA
FT                   VSVLELKNLGYDVSTLSNKRNALQQEVAVLQAKIEQQRHTVASLKAKMDNAKVNLDLTI
FT                   VRAPGDGVIDNMYVSPNTPIEIHKPVFSFIDTANYYIQANFNETDLRNVRQGDKAYIIL
FT                   RMYYFDKIFHGVVVNSLWAAERQSTAPKSQIQVVTNQNEWLLLPQRFPLQIKILDPDPD
FT                   YPLNPGASAYVYISTKR"
     gtgaaagaga agtttgccac atggtataaa atagcaacta aacatatccg gtttttcttt        60
     agttattcta tccctatgtt ttttaaaaag gccaaaaatt acattaatct tcccattatt       120
     gtcgttggct tggctcttat tattggtctt tttcatttat tttcctattt gatccctttc       180
     actgacaatg cgtttgttgt tactaatgtg acccctgtag ctgctgatgt atctggtttt       240
     attactgaaa tctatgtaaa gaatggccaa aaagtaaaga agaacgatcc tatatttagc       300
     gtttacaggg ttccttatga gttggcttat cagcaagcaa tggctgatta caaggaagga       360
     ttaaaaaaaa tagacgtatt tcaaaagcag attgaaagaa cggttgcttt gattaaagca       420
     acggactctg agcttgaaaa agctcaattt gctcttggcc ttaaaaaaaa taagaacgtg       480
     gcagaagcag tatctgttct tgaattaaaa aatcttggtt atgatgtttc tactttaagt       540
     aataaaagaa atgctctgca acaggaagtg gcggttttgc aagccaagat tgaacaacaa       600
     agacatactg tcgccagcct taaggcaaaa atggataatg ccaaggttaa tcttgattta       660
     accattgtca gagctcctgg tgatggagtg atagataata tgtatgtctc tccaaatacc       720
     cctatcgaga tccataaacc ggtgttttct tttatagata ccgcaaatta ttatatccag       780
     gctaatttta atgaaacgga cttacgcaat gtacgtcaag gtgataaagc gtatattatt       840
     ttacgcatgt attattttga caaaatattt catggggttg ttgtcaactc gttatgggct       900
     gctgaacgac aaagcactgc tccaaagagt caaattcagg ttgttacaaa tcaaaatgaa       960
     tggctgttgc ttcctcagcg atttccatta caaatcaaga tattggatcc cgatcctgac      1020
     tatcctttaa atcctggcgc cagtgcttat gtttatatct caactaaaag ataa            1074
//

If you have problems or comments...

PBIL Back to PBIL home page