(data stored in ACNUC7421 zone)

EMBL: CP000675.PE160

CP000675.PE160       Location/Qualifiers
FT   CDS_pept        177749..179083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0161"
FT                   /product="hypothetical protein conserved within
FT                   Legionellae"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54160"
FT                   /protein_id="ABQ54160.1"
FT                   /translation="MTPIISHLLKIFPELNTQVKTDSLNWTFNTHLKQLGPDFYSKVAR
FT                   LHPILNVEYSVLCQRLRHNLSSPDYSSLEQIKEQLIDALKLAELLEYTYQHYLVVPREV
FT                   VRLRRHKAIYRELLTELSGYSFALDNPEPESLKTSLSLTQAIREKTAQSNWYRIFISRS
FT                   KRVINLLDNLDTGSKAFRDFVVLLDKYTNPFLAYLGWCFFAPRLFTNLFLILKHTIPGE
FT                   WMGEKEKSLDWSDRFYAHLQRRWFELANDSVWFTVGILNCFVLVGALAPLSVYLSLFAF
FT                   VFDVANTSLRAYIEIGRLQQLQKEYGELFDQEENEDQKKIIKEYQDSISYRIKFEILRS
FT                   FLSVGGAVAVVIAMALSVPALGIINPVIPLIGAVLLLALWGVSLYLNNKLDEYRPVDNI
FT                   EKPAPSVINKLSFFAPKNEKKESLHLSSKPEKDLEAEELIPTFTF"
     atgacaccga ttattagtca tttattaaaa atatttccag agctgaacac gcaagttaaa        60
     actgattctt tgaattggac gtttaacacg cacctgaagc aattgggccc tgatttttat       120
     tcgaaagtag ctcgtcttca tcccattctc aatgtggaat acagcgtatt gtgtcagcgc       180
     ttaaggcata atctgtcctc acctgattac agttctctcg agcaaatcaa ggaacagctg       240
     attgatgcac tcaaactggc tgaacttttg gaatatacct atcaacacta cctggttgtt       300
     ccacgcgaag tagtgcgttt acgtcgccat aaagccatat acagggaatt attgacggaa       360
     ttgtccgggt attcttttgc cttggataat ccggagccgg aatctctcaa gacaagctta       420
     tcgttgacgc aggccattcg tgagaaaact gctcaatcca attggtatag aatttttatc       480
     agcagaagta aacgagtcat taatcttttg gataatttag acactggttc aaaagcattt       540
     cgtgattttg tcgtgctgct tgataaatac actaatccat ttttggctta tttgggctgg       600
     tgtttttttg cccccagatt atttaccaat ctctttttaa ttttaaagca caccattcca       660
     ggggaatgga tgggcgaaaa agaaaaatca ctggattggt ccgatcgatt ttatgcccac       720
     ctgcaacgac ggtggtttga gctggccaat gacagcgttt ggtttacagt cgggattctc       780
     aattgcttcg tgctggtagg tgctttggca cctctctctg tttatttgtc tttgtttgcg       840
     tttgtttttg atgtcgccaa cacaagcctg cgtgcttaca tagagattgg tcgattacag       900
     cagttgcaaa aggaatatgg cgaactcttc gaccaggaag aaaatgaaga ccagaaaaag       960
     ataattaaag agtatcaaga ctcaatcagt tatcgcatta agtttgagat tttgcgctcc      1020
     tttttatcgg ttggcggggc agtcgctgtt gtgattgcaa tggctttatc agttcctgct      1080
     ttgggtatta taaatcctgt catccccttg attggggcag tgcttttgct agcgctatgg      1140
     ggcgtttcat tatacttgaa caacaagtta gatgaataca gacctgtcga taacattgaa      1200
     aaacctgctc cttccgttat caataaatta agcttttttg cccccaaaaa tgaaaaaaaa      1260
     gagagtctgc acctgtcttc caagccagaa aaggatcttg aggcagagga attgattcca      1320
     acgttcacct tttaa                                                       1335
//

If you have problems or comments...

PBIL Back to PBIL home page