(data stored in ACNUC7421 zone)

EMBL: CP000675.PE162

CP000675.PE162       Location/Qualifiers
FT   CDS_pept        181312..181422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54162"
FT                   /protein_id="ABQ54162.1"
FT                   /translation="MPAFYVIIKVYRMGGDLASTWVAKPEVHAEKEISRK"
     atgccggcat tttatgttat aattaaagtg tacagaatgg ggggcgacct ggcttcgacg        60
     tgggttgcaa aaccggaagt gcatgccgag aaggagatct ctcgtaaata a                111
//

If you have problems or comments...

PBIL Back to PBIL home page