(data stored in ACNUC7421 zone)

EMBL: CP000675.PE17

CP000675.PE17        Location/Qualifiers
FT   CDS_pept        20687..21619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0017"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54017"
FT                   /protein_id="ABQ54017.1"
FT                   /translation="MFISQLKDKLASYDRYKEHRINGLKAVFVLELMILFYFFSSIDNP
FT                   YFYYFYAPITCFTVEAAGTTLKEKYMLLLYTLLGSILSIFLFGIISVYNVLFIFFVFFY
FT                   TLALYFLVLHHFKKMLVIVPLILSLASYSLIYGVEADSNFYIAINNALYTLAAMAVIFA
FT                   GLFIFPKKYYFDIWERAFLEVITGLESLSAKICKGEVKTIAIFSGIIVMERYSKMLPRN
FT                   IKCYSILKITILSFELILTMSYLLSFQKQLRKEYIIVLHHYLERLCQSCKARQPLILSD
FT                   QELPAFKETHELEILYQLILSWNYLCADG"
     atgtttatat ctcaactaaa agataagctt gcatcctacg ataggtataa agagcatcgt        60
     attaacggat taaaagcagt gtttgttttg gaactgatga ttttatttta ctttttttcc       120
     tccattgaca atccgtactt ctattatttt tatgctccaa tcacatgttt tactgtggag       180
     gcggcgggaa caaccctaaa agagaagtac atgcttttac tctataccct tttaggaagc       240
     atactctcta tattcttgtt cggcataatt tctgtataca atgtgctttt catttttttc       300
     gtttttttct ataccttggc tctttatttc ctcgtgcttc accattttaa aaaaatgctt       360
     gttattgttc cattgatact aagtttggcg tcctattccc tgatttatgg tgtggaggca       420
     gatagcaatt tttatattgc tattaataat gctttatata ccttggcagc catggcggta       480
     atcttcgctg gattatttat ttttcccaaa aagtattatt ttgatatttg ggagcgtgct       540
     tttctcgaag tcattaccgg cctggaatct ctatctgcaa aaatttgtaa gggagaagtc       600
     aaaactatcg ctattttttc aggcattatc gtgatggagc gttattccaa aatgctgcca       660
     agaaatatta agtgctacag tatattaaag ataaccattt tatcttttga gttaatcttg       720
     actatgtctt acttgctgtc ttttcaaaag caactgcgta aggaatacat tattgtttta       780
     catcattatc ttgaacgtct ttgtcaatcc tgtaaagcga gacaaccact gatactctca       840
     gaccaggagc tgcctgcatt taaagaaacg catgagttgg aaattttgta tcaattaatt       900
     ttaagctgga attacttatg cgccgatggt tag                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page